Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
27257
Gene name Gene Name - the full gene name approved by the HGNC.
LSM1 homolog, mRNA degradation associated
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
LSM1
Synonyms (NCBI Gene) Gene synonyms aliases
CASM, FICUS, YJL124C
Chromosome Chromosome number
8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
8p11.23
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the LSm family of RNA-binding proteins. LSm proteins form stable heteromers that bind specifically to the 3`-terminal oligo(U) tract of U6 snRNA and may play a role in pre-mRNA splicing by mediating U4/U6 snRNP formation. Inc
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT028662 hsa-miR-30a-5p Proteomics 18668040
MIRT030039 hsa-miR-26b-5p Microarray 19088304
MIRT459086 hsa-miR-128-3p PAR-CLIP 23592263
MIRT459085 hsa-miR-216a-3p PAR-CLIP 23592263
MIRT459084 hsa-miR-3681-3p PAR-CLIP 23592263
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000290 Process Deadenylation-dependent decapping of nuclear-transcribed mRNA IBA 21873635
GO:0000339 Function RNA cap binding IBA 21873635
GO:0000375 Process RNA splicing, via transesterification reactions TAS 10369684
GO:0000932 Component P-body IBA 21873635
GO:0003723 Function RNA binding HDA 22658674, 22681889
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
607281 20472 ENSG00000175324
Protein
UniProt ID O15116
Protein name U6 snRNA-associated Sm-like protein LSm1 (Cancer-associated Sm-like) (Small nuclear ribonuclear CaSm)
Protein function Plays a role in the degradation of histone mRNAs, the only eukaryotic mRNAs that are not polyadenylated (PubMed:18172165). Probably also part of an LSm subunits-containing complex involved in the general process of mRNA degradation (By similarit
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01423 LSM 8 76 LSM domain Domain
Sequence
MNYMPGTASLIEDIDKKHLVLLRDGRTLIGFLRSIDQFANLVLHQTVERIHVGKKYGDIP
RGIFVVRGENVVLLGE
IDLEKESDTPLQQVSIEEILEEQRVEQQTKLEAEKLKVQALKDR
GLSIPRADTLDEY
Sequence length 133
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  RNA degradation   mRNA decay by 5' to 3' exoribonuclease
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Schizophrenia Schizophrenia rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346
View all (12 more)
22037555, 28991256
Associations from Text Mining
Disease Name Relationship Type References
Breast Neoplasms Associate 17001308, 20940404, 35692083, 37995895
Epilepsy Associate 40658715
Neoplasm Metastasis Associate 37995895
Neoplasms Associate 37995895
Schizophrenia Associate 22037555