Gene Gene information from NCBI Gene database.
Entrez ID 27257
Gene name LSM1 homolog, mRNA degradation associated
Gene symbol LSM1
Synonyms (NCBI Gene)
CASMFICUSYJL124C
Chromosome 8
Chromosome location 8p11.23
Summary This gene encodes a member of the LSm family of RNA-binding proteins. LSm proteins form stable heteromers that bind specifically to the 3`-terminal oligo(U) tract of U6 snRNA and may play a role in pre-mRNA splicing by mediating U4/U6 snRNP formation. Inc
miRNA miRNA information provided by mirtarbase database.
111
miRTarBase ID miRNA Experiments Reference
MIRT028662 hsa-miR-30a-5p Proteomics 18668040
MIRT030039 hsa-miR-26b-5p Microarray 19088304
MIRT459086 hsa-miR-128-3p PAR-CLIP 23592263
MIRT459085 hsa-miR-216a-3p PAR-CLIP 23592263
MIRT459084 hsa-miR-3681-3p PAR-CLIP 23592263
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
24
GO ID Ontology Definition Evidence Reference
GO:0000290 Process Deadenylation-dependent decapping of nuclear-transcribed mRNA IBA
GO:0000375 Process RNA splicing, via transesterification reactions TAS 10369684
GO:0000932 Component P-body IBA
GO:0000932 Component P-body IEA
GO:0000956 Process Nuclear-transcribed mRNA catabolic process IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
607281 20472 ENSG00000175324
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O15116
Protein name U6 snRNA-associated Sm-like protein LSm1 (Cancer-associated Sm-like) (Small nuclear ribonuclear CaSm)
Protein function Plays a role in the degradation of histone mRNAs, the only eukaryotic mRNAs that are not polyadenylated (PubMed:18172165). Probably also part of an LSm subunits-containing complex involved in the general process of mRNA degradation (By similarit
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01423 LSM 8 76 LSM domain Domain
Sequence
MNYMPGTASLIEDIDKKHLVLLRDGRTLIGFLRSIDQFANLVLHQTVERIHVGKKYGDIP
RGIFVVRGENVVLLGE
IDLEKESDTPLQQVSIEEILEEQRVEQQTKLEAEKLKVQALKDR
GLSIPRADTLDEY
Sequence length 133
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  RNA degradation   mRNA decay by 5' to 3' exoribonuclease
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
5
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
FICUS syndrome Likely pathogenic; Pathogenic rs2130643543 RCV005410947
Global developmental delay Likely pathogenic; Pathogenic rs2130643543 RCV002254144
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Complex neurodevelopmental disorder Uncertain significance rs775468919 RCV001254677
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Breast Neoplasms Associate 17001308, 20940404, 35692083, 37995895
Epilepsy Associate 40658715
Neoplasm Metastasis Associate 37995895
Neoplasms Associate 37995895
Schizophrenia Associate 22037555