Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
27250
Gene name Gene Name - the full gene name approved by the HGNC.
Programmed cell death 4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PDCD4
Synonyms (NCBI Gene) Gene synonyms aliases
H731
Chromosome Chromosome number
10
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
10q25.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene is a tumor suppressor and encodes a protein that binds to the eukaryotic translation initiation factor 4A1 and inhibits its function by preventing RNA binding. Alternative splicing results in multiple transcript variants. [provided by RefSeq, De
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT003054 hsa-miR-21-5p Luciferase reporter assay, Westren blot 17968323
MIRT003054 hsa-miR-21-5p Luciferase reporter assay, Western blot 18372920
MIRT003054 hsa-miR-21-5p qRT-PCR, Western blot 19906824
MIRT003054 hsa-miR-21-5p Luciferase reporter assay, Western blot 18270520
MIRT003054 hsa-miR-21-5p Western blot, Northern blot 19013014
Transcription factors
Transcription factor Regulation Reference
MYB Unknown 23606399
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0003723 Function RNA binding IEA
GO:0005515 Function Protein binding IPI 12054647, 16357133, 18296639, 19204291, 21163940, 24413684, 25416956, 28514442, 32296183
GO:0005634 Component Nucleus IBA 21873635
GO:0005634 Component Nucleus IMP 16357133
GO:0005634 Component Nucleus ISS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
608610 8763 ENSG00000150593
Protein
UniProt ID Q53EL6
Protein name Programmed cell death protein 4 (Neoplastic transformation inhibitor protein) (Nuclear antigen H731-like) (Protein 197/15a)
Protein function Inhibits translation initiation and cap-dependent translation. May excert its function by hindering the interaction between EIF4A1 and EIF4G. Inhibits the helicase activity of EIF4A. Modulates the activation of JUN kinase. Down-regulates the exp
PDB 2GGF , 2KZT , 2RG8 , 2ZU6 , 3EIJ , 8XXL , 8XXM , 8XXN , 9BKD , 9BLN
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02847 MA3 164 275 MA3 domain Family
PF02847 MA3 327 440 MA3 domain Family
Tissue specificity TISSUE SPECIFICITY: Up-regulated in proliferative cells. Highly expressed in epithelial cells of the mammary gland. Reduced expression in lung cancer and colon carcinoma. {ECO:0000269|PubMed:10632927, ECO:0000269|PubMed:12898601, ECO:0000269|PubMed:164496
Sequence
MDVENEQILNVNPADPDNLSDSLFSGDEENAGTEEIKNEINGNWISASSINEARINAKAK
RRLRKNSSRDSGRGDSVSDSGSDALRSGLTVPTSPKGRLLDRRSRSGKGRGLPKKGGAGG
KGVWGTPGQVYDVEEVDVKDPNYDDDQENCVYETVVLPLDERAFEKTLTPIIQEYFEHGD
TNEVAEMLRDLNLGEMKSGVPVLAVSLALEGKASHREMTSKLLSDLCGTVMSTTDVEKSF
DKLLKDLPELALDTPRAPQLVGQFIARAVGDGILC
NTYIDSYKGTVDCVQARAALDKATV
LLSMSKGGKRKDSVWGSGGGQQSVNHLVKEIDMLLKEYLLSGDISEAEHCLKELEVPHFH
HELVYEAIIMVLESTGESTFKMILDLLKSLWKSSTITVDQMKRGYERIYNEIPDINLDVP
HSYSVLERFVEECFQAGIIS
KQLRDLCPSRGRKRFVSEGDGGRLKPESY
Sequence length 469
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Proteoglycans in cancer
MicroRNAs in cancer
  Gene and protein expression by JAK-STAT signaling after Interleukin-12 stimulation
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Breast cancer Malignant neoplasm of breast rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158
View all (309 more)
Lung cancer Malignant neoplasm of lung rs121913530, rs121913529, rs878855122, rs1057519784, rs770315135 27323401
Unknown
Disease term Disease name Evidence References Source
Diabetes Diabetes GWAS
Associations from Text Mining
Disease Name Relationship Type References
Acute Kidney Injury Associate 34027766
Adenocarcinoma Inhibit 17849461
Adenocarcinoma Associate 36829221
Adenocarcinoma of Lung Associate 23877371
Adenocarcinoma of Lung Inhibit 28336923
Adenoma Inhibit 17849461
Asthma Associate 23606399
Atherosclerosis Associate 30205366
Brain Neoplasms Inhibit 29110584
Breast Neoplasms Associate 17991735, 19419954, 19633292, 21700716, 22524830, 23102376, 25611378, 26452030, 30365117, 30496290, 31556312, 32632815, 33744861, 35470783, 36552834
View all (2 more)