Gene Gene information from NCBI Gene database.
Entrez ID 27250
Gene name Programmed cell death 4
Gene symbol PDCD4
Synonyms (NCBI Gene)
H731
Chromosome 10
Chromosome location 10q25.2
Summary This gene is a tumor suppressor and encodes a protein that binds to the eukaryotic translation initiation factor 4A1 and inhibits its function by preventing RNA binding. Alternative splicing results in multiple transcript variants. [provided by RefSeq, De
miRNA miRNA information provided by mirtarbase database.
971
miRTarBase ID miRNA Experiments Reference
MIRT003054 hsa-miR-21-5p Luciferase reporter assayWestren blot 17968323
MIRT003054 hsa-miR-21-5p Luciferase reporter assayWestern blot 18372920
MIRT003054 hsa-miR-21-5p qRT-PCRWestern blot 19906824
MIRT003054 hsa-miR-21-5p Luciferase reporter assayWestern blot 18270520
MIRT003054 hsa-miR-21-5p Western blotNorthern blot 19013014
Transcription factors Transcription factors information provided by TRRUST V2 database.
1
Transcription factor Regulation Reference
MYB Unknown 23606399
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
31
GO ID Ontology Definition Evidence Reference
GO:0003723 Function RNA binding IEA
GO:0005515 Function Protein binding IPI 12054647, 16357133, 18296639, 19204291, 21163940, 24413684, 25416956, 28514442, 32296183, 33961781
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IEA
GO:0005634 Component Nucleus IMP 16357133
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
608610 8763 ENSG00000150593
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q53EL6
Protein name Programmed cell death protein 4 (Neoplastic transformation inhibitor protein) (Nuclear antigen H731-like) (Protein 197/15a)
Protein function Inhibits translation initiation and cap-dependent translation. May excert its function by hindering the interaction between EIF4A1 and EIF4G. Inhibits the helicase activity of EIF4A. Modulates the activation of JUN kinase. Down-regulates the exp
PDB 2GGF , 2KZT , 2RG8 , 2ZU6 , 3EIJ , 8XXL , 8XXM , 8XXN , 9BKD , 9BLN
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02847 MA3 164 275 MA3 domain Family
PF02847 MA3 327 440 MA3 domain Family
Tissue specificity TISSUE SPECIFICITY: Up-regulated in proliferative cells. Highly expressed in epithelial cells of the mammary gland. Reduced expression in lung cancer and colon carcinoma. {ECO:0000269|PubMed:10632927, ECO:0000269|PubMed:12898601, ECO:0000269|PubMed:164496
Sequence
MDVENEQILNVNPADPDNLSDSLFSGDEENAGTEEIKNEINGNWISASSINEARINAKAK
RRLRKNSSRDSGRGDSVSDSGSDALRSGLTVPTSPKGRLLDRRSRSGKGRGLPKKGGAGG
KGVWGTPGQVYDVEEVDVKDPNYDDDQENCVYETVVLPLDERAFEKTLTPIIQEYFEHGD
TNEVAEMLRDLNLGEMKSGVPVLAVSLALEGKASHREMTSKLLSDLCGTVMSTTDVEKSF
DKLLKDLPELALDTPRAPQLVGQFIARAVGDGILC
NTYIDSYKGTVDCVQARAALDKATV
LLSMSKGGKRKDSVWGSGGGQQSVNHLVKEIDMLLKEYLLSGDISEAEHCLKELEVPHFH
HELVYEAIIMVLESTGESTFKMILDLLKSLWKSSTITVDQMKRGYERIYNEIPDINLDVP
HSYSVLERFVEECFQAGIIS
KQLRDLCPSRGRKRFVSEGDGGRLKPESY
Sequence length 469
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Proteoglycans in cancer
MicroRNAs in cancer
  Gene and protein expression by JAK-STAT signaling after Interleukin-12 stimulation