Gene Gene information from NCBI Gene database.
Entrez ID 27246
Gene name Ring finger protein 115
Gene symbol RNF115
Synonyms (NCBI Gene)
BCA2RABRING7ZFP364ZNF364
Chromosome 1
Chromosome location 1q21.1
miRNA miRNA information provided by mirtarbase database.
367
miRTarBase ID miRNA Experiments Reference
MIRT051949 hsa-let-7b-5p CLASH 23622248
MIRT041801 hsa-miR-484 CLASH 23622248
MIRT041372 hsa-miR-193b-3p CLASH 23622248
MIRT717495 hsa-miR-6841-5p HITS-CLIP 19536157
MIRT717494 hsa-miR-6755-5p HITS-CLIP 19536157
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
34
GO ID Ontology Definition Evidence Reference
GO:0000209 Process Protein polyubiquitination IEA
GO:0004842 Function Ubiquitin-protein transferase activity IDA 18819927
GO:0005515 Function Protein binding IPI 16925951, 19690564, 21516116, 25416956, 31515488, 32296183, 32814053, 35044719
GO:0005634 Component Nucleus IEA
GO:0005737 Component Cytoplasm IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
619535 18154 ENSG00000265491
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9Y4L5
Protein name E3 ubiquitin-protein ligase RNF115 (EC 2.3.2.27) (RING finger protein 115) (RING-type E3 ubiquitin transferase RNF115) (Rab7-interacting RING finger protein) (Rabring 7) (Zinc finger protein 364)
Protein function E3 ubiquitin-protein ligase that catalyzes the 'Lys-48'- and/or 'Lys-63'-linked polyubiquitination of various substrates and thereby plays a role in a number of signaling pathways including autophagy, innate immunity, cell proliferation and cell
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13639 zf-RING_2 226 269 Ring finger domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed at extremely low levels in normal breast, prostate, lung, colon. Higher levels of expression are detected in heart, skeletal muscle, testis as well as in breast and prostate cancer cells. {ECO:0000269|PubMed:16288031}.
Sequence
MAEASAAGADSGAAVAAHRFFCHFCKGEVSPKLPEYICPRCESGFIEEVTDDSSFLGGGG
SRIDNTTTTHFAELWGHLDHTMFFQDFRPFLSSSPLDQDNRANERGHQTHTDFWGARPPR
LPLGRRYRSRGSSRPDRSPAIEGILQHIFAGFFANSAIPGSPHPFSWSGMLHSNPGDYAW
GQTGLDAIVTQLLGQLENTGPPPADKEKITSLPTVTVTQEQVDMGLECPVCKEDYTVEEE
VRQLPCNHFFHSSCIVPWLELHDTCPVCR
KSLNGEDSTRQSQSTEASASNRFSNDSQLHD
RWTF
Sequence length 304
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Antigen processing: Ubiquitination & Proteasome degradation