TNFRSF21 (TNF receptor superfamily member 21)

Gene
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
27242
Gene name Gene Name - the full gene name approved by the HGNC.
TNF receptor superfamily member 21
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TNFRSF21
Synonyms (NCBI Gene) Gene synonyms aliases
BM-018, CD358, DR6
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6p12.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the tumor necrosis factor receptor superfamily. The encoded protein activates nuclear factor kappa-B and mitogen-activated protein kinase 8 (also called c-Jun N-terminal kinase 1), and induces cell apoptosis. Through its deat
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(466)
miRTarBase ID miRNA Experiments Reference
MIRT002620 hsa-miR-124-3p Microarray 15685193
MIRT016429 hsa-miR-193b-3p Microarray 20304954
MIRT020190 hsa-miR-130b-3p Sequencing 20371350
MIRT002620 hsa-miR-124-3p Microarray 18668037
MIRT002620 hsa-miR-124-3p Microarray 15685193
Transcription factors
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(1)
Transcription factor Regulation Reference
VDR Activation 12520529
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(33)
GO ID Ontology Definition Evidence Reference
GO:0001783 Process B cell apoptotic process ISS
GO:0002250 Process Adaptive immune response IBA 21873635
GO:0002250 Process Adaptive immune response ISS
GO:0005515 Function Protein binding IPI 23559013, 32296183
GO:0005737 Component Cytoplasm IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
605732 13469 ENSG00000146072
Protein
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID O75509
Protein name Tumor necrosis factor receptor superfamily member 21 (Death receptor 6) (CD antigen CD358)
Protein function Promotes apoptosis, possibly via a pathway that involves the activation of NF-kappa-B. Can also promote apoptosis mediated by BAX and by the release of cytochrome c from the mitochondria into the cytoplasm. Trophic-factor deprivation triggers th
PDB 2DBH , 3QO4 , 3U3P , 3U3Q , 3U3S , 3U3T , 3U3V
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00020 TNFR_c6 51 → 88 TNFR/NGFR cysteine-rich region Domain
PF00020 TNFR_c6 91 → 131 TNFR/NGFR cysteine-rich region Domain
PF00020 TNFR_c6 171 → 211 TNFR/NGFR cysteine-rich region Domain
PF00531 Death 417 → 498 Death domain Domain
Tissue specificity TISSUE SPECIFICITY: Detected in fetal spinal cord and in brain neurons, with higher levels in brain from Alzheimer disease patients (at protein level). Highly expressed in heart, brain, placenta, pancreas, lymph node, thymus and prostate. Detected at lowe
Sequence 
MGTSPSSSTALASCSRIARRATATMIAGSLLLLGFLSTTTAQPEQKASNLIGTYRHVDRA
TGQVLTCDKCPAGTYVSEHCTNTSLRVCSSCPVGTFTRHENGIEKCHDCSQPCPWPMIEK
LPCAALTDRECTCPPGMFQSNATCAPHTVCPVGWGVRKKGTETEDVRCKQCARGTFSDVP
SSVMKCKAYTDCLSQNLVVIKPGTKETDNVCGTLPSFSSSTSPSPGTAIFPRPEHMETHE
VPSSTYVPKGMNSTESNSSASVRPKVLSSIQEGTVPDNTSSARGKEDVNKTLPNLQVVNH
QQGPHHRHILKLLPSMEATGGEKSSTPIKGPKRGHPRQNLHKHFDINEHLPWMIVLFLLL
VLVVIVVCSIRKSSRTLKKGPRQDPSAIVEKAGLKKSMTPTQNREKWIYYCNGHGIDILK
LVAAQVGSQWKDIYQFLCNASEREVAAFSNGYTADHERAYAALQHWTIRGPEASLAQLIS
ALRQHRRNDVVEKIRGLMEDTTQLETDKLALPMSPSPLSPSPIPSPNAKLENSALLTVEP
SPQDKNKGFFVDESEPLLRCDSTSSGSSALSRNGSFITKEKKDTVLRQVRLDPCDLQPIF
DDMLHFLNPEELRVIEEIPQAEDKLDRLFEIIGVKSQEASQTLLDSVYSHLPDLL
Sequence length 655
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  Cytokine-cytokine receptor interaction   PPARA activates gene expression
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (2)
Causal
Disease term Disease name dbSNP ID References
Amyotrophic lateral sclerosis Amyotrophic Lateral Sclerosis, Amyotrophic Lateral Sclerosis, Guam Form rs267607084, rs312262720, rs312262752, rs121908287, rs121908288, rs29001584, rs28941475, rs121434378, rs386134173, rs386134174, rs80356730, rs80356727, rs4884357, rs80356717, rs80356733
View all (171 more)		 24113175
Prostate cancer Malignant neoplasm of prostate rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582 11753679
Show/Hide Unknown Diseases (2)
Unknown
Disease term Disease name Evidence References Source
Ischemic Stroke Ischemic Stroke GWAS
Panic Disorder Panic Disorder GWAS
Show/Hide Text Mining Associations (44)
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma Associate 34724890
Adenocarcinoma of Lung Stimulate 40109864
Alopecia Areata Associate 16417220
Arthritis Juvenile Associate 10513798
Arthritis Rheumatoid Associate 10765920, 37510374
Arthritis Rheumatoid Inhibit 11247876, 6428222, 7788148
Biliary Atresia Associate 9149338
Breast Neoplasms Associate 40332226
Carcinoma Squamous Cell Associate 35593591
CD8 Deficiency Familial Associate 7972086