Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
27241
Gene name Gene Name - the full gene name approved by the HGNC.
Bardet-Biedl syndrome 9
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
BBS9
Synonyms (NCBI Gene) Gene synonyms aliases
B1, C18, D1, PTHB1
Chromosome Chromosome number
7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
7p14.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene is downregulated by parathyroid hormone in osteoblastic cells, and therefore is thought to be involved in parathyroid hormone action in bones. The exact function of this gene has not yet been determined. Alternatively spliced transcript variants
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs61753526 C>T Conflicting-interpretations-of-pathogenicity Non coding transcript variant, missense variant, genic downstream transcript variant, coding sequence variant
rs61764068 A>T Conflicting-interpretations-of-pathogenicity Genic downstream transcript variant, non coding transcript variant, missense variant, intron variant, coding sequence variant
rs137852856 C>T Pathogenic Non coding transcript variant, genic downstream transcript variant, coding sequence variant, stop gained
rs137852857 G>A Pathogenic Non coding transcript variant, missense variant, coding sequence variant
rs137852858 C>T Pathogenic Non coding transcript variant, coding sequence variant, stop gained
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT017564 hsa-miR-335-5p Microarray 18185580
MIRT650436 hsa-miR-5582-3p HITS-CLIP 23824327
MIRT650435 hsa-miR-8084 HITS-CLIP 23824327
MIRT650434 hsa-miR-28-3p HITS-CLIP 23824327
MIRT650433 hsa-miR-5088-3p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000242 Component Pericentriolar material IDA 22139371
GO:0003674 Function Molecular_function ND
GO:0005515 Function Protein binding IPI 17574030, 19081074, 20080638, 22072986, 22139371, 22500027, 24550735, 25552655, 27173435, 28514442, 29039417
GO:0005829 Component Cytosol TAS
GO:0005929 Component Cilium IDA 22139371, 23943788, 24550735
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
607968 30000 ENSG00000122507
Protein
UniProt ID Q3SYG4
Protein name Protein PTHB1 (Bardet-Biedl syndrome 9 protein) (Parathyroid hormone-responsive B1 gene protein)
Protein function The BBSome complex is thought to function as a coat complex required for sorting of specific membrane proteins to the primary cilia. The BBSome complex is required for ciliogenesis but is dispensable for centriolar satellite function. This cilio
PDB 4YD8 , 6XT9
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF14727 PHTB1_N 1 418 PTHB1 N-terminus Family
PF14728 PHTB1_C 441 819 PTHB1 C-terminus Family
Tissue specificity TISSUE SPECIFICITY: Widely expressed. Expressed in adult heart, skeletal muscle, lung, liver, kidney, placenta and brain, and in fetal kidney, lung, liver and brain. {ECO:0000269|PubMed:10221542, ECO:0000269|PubMed:16380913}.
Sequence
MSLFKARDWWSTILGDKEEFDQGCLCLANVDNSGNGQDKIIVGSFMGYLRIFSPHPAKTG
DGAQAEDLLLEVDLRDPVLQVEVGKFVSGTEMLHLAVLHSRKLCVYSVSGTLGNVEHGNQ
CQMKLMYEHNLQRTACNMTYGSFGGVKGRDLICIQSMDGMLMVFEQESYAFGRFLPGFLL
PGPLAYSSRTDSFLTVSSCQQVESYKYQVLAFATDADKRQETEQQKLGSGKRLVVDWTLN
IGEQALDICIVSFNQSASSVFVLGERNFFCLKDNGQIRFMKKLDWSPSCFLPYCSVSEGT
INTLIGNHNNMLHIYQDVTLKWATQLPHIPVAVRVGCLHDLKGVIVTLSDDGHLQCSYLG
TDPSLFQAPNVQSRELNYDELDVEMKELQKIIKDVNKSQGVWPMTEREDDLNVSVVVS
PN
FDSVSQATDVEVGTDLVPSVTVKVTLQNRVILQKAKLSVYVQPPLELTCDQFTFEFMTPD
LTRTVSFSVYLKRSYTPSELEGNAVVSYSRPTDRNPDGIPRVIQCKFRLPLKLICLPGQP
SKTASHKITIDTNKSPVSLLSLFPGFASQSDDDQVNVMGFHFLGGARITVLASKTSQRYR
IQSEQFEDLWLITNELILRLQEYFEKQGVKDFACSFSGSIPLQEYFELIDHHFELRINGE
KLEELLSERAVQFRAIQRRLLARFKDKTPAPLQHLDTLLDGTYKQVIALADAVEENQGNL
FQSFTRLKSATHLVILLIALWQKLSADQVAILEAAFLPLQEDTQELGWEETVDAAISHLL
KTCLSKSSKEQALNLNSQLNIPKDTSQLKKHITLLCDRL
SKGGRLCLSTDAAAPQTMVMP
GGCTTIPESDLEERSVEQDSTELFTNHRHLTAETPRPEVSPLQGVSE
Sequence length 887
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    BBSome-mediated cargo-targeting to cilium
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Bardet-biedl syndrome Bardet-Biedl Syndrome, BARDET-BIEDL SYNDROME 9, Bardet-Biedl syndrome 1 (disorder), Bardet-Biedl syndrome rs397704728, rs397515335, rs397515337, rs267607031, rs121918327, rs587777801, rs587777802, rs121918328, rs587777803, rs549625604, rs137852837, rs137852833, rs137852835, rs267606719, rs199874059
View all (560 more)
16380913, 30614526, 26085087, 26518167
Colorectal neoplasms Secondary malignant neoplasm of colon and/or rectum rs28929483, rs63751108, rs28929484, rs63749831, rs63750047, rs63751207, rs63749811, rs1553350126, rs63750875, rs63750955, rs587776706, rs63750871, rs587776715, rs63751466, rs63750049
View all (1682 more)
30738427
Craniosynostosis Craniosynostosis, Craniosynostosis, Type 1 rs104893895, rs587777006, rs587777007, rs587777008, rs587777010, rs864321680, rs864321681, rs1057517670, rs1064794325, rs1555750816, rs1599823350 23160099
Cryptorchidism Cryptorchidism rs121912555, rs104894697, rs104894698, rs398122886
Unknown
Disease term Disease name Evidence References Source
Leprosy Leprosy 27976721 ClinVar, GWAS
Trigonocephaly Trigonocephaly 23160099 ClinVar
Colorectal Cancer Colorectal Cancer In summary, our data strongly demonstrated that upregulation of GRB7 conferred MEKi resistance in CRC cells with KRAS mutations by mediating RTK signaling through the recruitment of PLK1. GWAS, CBGDA
Sagittal craniosynostosis Sagittal craniosynostosis GWAS
Associations from Text Mining
Disease Name Relationship Type References
Acrocephalosyndactylia Associate 30651579
Acute Kidney Injury Associate 26083657, 30678657
Asthma Associate 31557306
Atrial Fibrillation Associate 30678657
Bardet Biedl Syndrome Associate 16380913, 22353939, 23404957, 26085087, 26846096, 27708425, 29590217, 29806606, 31294530, 31488071, 31530639, 33138063, 33616283, 33771153, 33964006
View all (3 more)
Ciliopathies Associate 34354814
Colorectal Neoplasms Associate 11720442
Cough Associate 31557306
Craniosynostoses Associate 23160099, 30651579, 35627201
Delirium Associate 30678657