Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
27241
Gene name Gene Name - the full gene name approved by the HGNC.
Bardet-Biedl syndrome 9
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
BBS9
Synonyms (NCBI Gene) Gene synonyms aliases
B1, C18, D1, PTHB1
Chromosome Chromosome number
7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
7p14.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene is downregulated by parathyroid hormone in osteoblastic cells, and therefore is thought to be involved in parathyroid hormone action in bones. The exact function of this gene has not yet been determined. Alternatively spliced transcript variants
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs61753526 C>T Conflicting-interpretations-of-pathogenicity Non coding transcript variant, missense variant, genic downstream transcript variant, coding sequence variant
rs61764068 A>T Conflicting-interpretations-of-pathogenicity Genic downstream transcript variant, non coding transcript variant, missense variant, intron variant, coding sequence variant
rs137852856 C>T Pathogenic Non coding transcript variant, genic downstream transcript variant, coding sequence variant, stop gained
rs137852857 G>A Pathogenic Non coding transcript variant, missense variant, coding sequence variant
rs137852858 C>T Pathogenic Non coding transcript variant, coding sequence variant, stop gained
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT017564 hsa-miR-335-5p Microarray 18185580
MIRT650436 hsa-miR-5582-3p HITS-CLIP 23824327
MIRT650435 hsa-miR-8084 HITS-CLIP 23824327
MIRT650434 hsa-miR-28-3p HITS-CLIP 23824327
MIRT650433 hsa-miR-5088-3p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000242 Component Pericentriolar material IDA 22139371
GO:0003674 Function Molecular_function ND
GO:0005515 Function Protein binding IPI 17574030, 19081074, 20080638, 22072986, 22139371, 22500027, 24550735, 25552655, 27173435, 28514442, 29039417, 33961781
GO:0005654 Component Nucleoplasm IDA
GO:0005737 Component Cytoplasm IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
607968 30000 ENSG00000122507
Protein
UniProt ID Q3SYG4
Protein name Protein PTHB1 (Bardet-Biedl syndrome 9 protein) (Parathyroid hormone-responsive B1 gene protein)
Protein function The BBSome complex is thought to function as a coat complex required for sorting of specific membrane proteins to the primary cilia. The BBSome complex is required for ciliogenesis but is dispensable for centriolar satellite function. This cilio
PDB 4YD8 , 6XT9
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF14727 PHTB1_N 1 418 PTHB1 N-terminus Family
PF14728 PHTB1_C 441 819 PTHB1 C-terminus Family
Tissue specificity TISSUE SPECIFICITY: Widely expressed. Expressed in adult heart, skeletal muscle, lung, liver, kidney, placenta and brain, and in fetal kidney, lung, liver and brain. {ECO:0000269|PubMed:10221542, ECO:0000269|PubMed:16380913}.
Sequence
MSLFKARDWWSTILGDKEEFDQGCLCLANVDNSGNGQDKIIVGSFMGYLRIFSPHPAKTG
DGAQAEDLLLEVDLRDPVLQVEVGKFVSGTEMLHLAVLHSRKLCVYSVSGTLGNVEHGNQ
CQMKLMYEHNLQRTACNMTYGSFGGVKGRDLICIQSMDGMLMVFEQESYAFGRFLPGFLL
PGPLAYSSRTDSFLTVSSCQQVESYKYQVLAFATDADKRQETEQQKLGSGKRLVVDWTLN
IGEQALDICIVSFNQSASSVFVLGERNFFCLKDNGQIRFMKKLDWSPSCFLPYCSVSEGT
INTLIGNHNNMLHIYQDVTLKWATQLPHIPVAVRVGCLHDLKGVIVTLSDDGHLQCSYLG
TDPSLFQAPNVQSRELNYDELDVEMKELQKIIKDVNKSQGVWPMTEREDDLNVSVVVS
PN
FDSVSQATDVEVGTDLVPSVTVKVTLQNRVILQKAKLSVYVQPPLELTCDQFTFEFMTPD
LTRTVSFSVYLKRSYTPSELEGNAVVSYSRPTDRNPDGIPRVIQCKFRLPLKLICLPGQP
SKTASHKITIDTNKSPVSLLSLFPGFASQSDDDQVNVMGFHFLGGARITVLASKTSQRYR
IQSEQFEDLWLITNELILRLQEYFEKQGVKDFACSFSGSIPLQEYFELIDHHFELRINGE
KLEELLSERAVQFRAIQRRLLARFKDKTPAPLQHLDTLLDGTYKQVIALADAVEENQGNL
FQSFTRLKSATHLVILLIALWQKLSADQVAILEAAFLPLQEDTQELGWEETVDAAISHLL
KTCLSKSSKEQALNLNSQLNIPKDTSQLKKHITLLCDRL
SKGGRLCLSTDAAAPQTMVMP
GGCTTIPESDLEERSVEQDSTELFTNHRHLTAETPRPEVSPLQGVSE
Sequence length 887
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    BBSome-mediated cargo-targeting to cilium
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Bardet-Biedl Syndrome bardet-biedl syndrome 9, bardet-biedl syndrome, Bardet-Biedl syndrome 1 rs1229015450, rs137852858, rs863224534, rs137962929, rs747388658, rs587777811, rs869025208, rs201938124, rs1326810030, rs746797123, rs781174906, rs767005321, rs606231137, rs137852856, rs886039875
View all (11 more)
N/A
retinal dystrophy Retinal dystrophy rs767005321, rs606231137 N/A
Nephronophthisis nephronophthisis 4 rs137852856 N/A
Retinitis Pigmentosa retinitis pigmentosa rs1584179629 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Colorectal Cancer Metastasis in stage I-III microsatellite instability low/stable colorectal cancer (time to event) N/A N/A GWAS
Congestive Heart Failure Congestive heart failure N/A N/A GWAS
Dementia Dementia N/A N/A GWAS
Leprosy Leprosy N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Acrocephalosyndactylia Associate 30651579
Acute Kidney Injury Associate 26083657, 30678657
Asthma Associate 31557306
Atrial Fibrillation Associate 30678657
Bardet Biedl Syndrome Associate 16380913, 22353939, 23404957, 26085087, 26846096, 27708425, 29590217, 29806606, 31294530, 31488071, 31530639, 33138063, 33616283, 33771153, 33964006
View all (3 more)
Ciliopathies Associate 34354814
Colorectal Neoplasms Associate 11720442
Cough Associate 31557306
Craniosynostoses Associate 23160099, 30651579, 35627201
Delirium Associate 30678657