IL17B (interleukin 17B)

Gene Gene information from NCBI Gene database.
Gene Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID 27190
Gene name Interleukin 17B
Gene symbol IL17B
Synonyms (NCBI Gene)
IL-17BIL-20NIRFZCYTO7
Chromosome 5
Chromosome location 5q32
Summary The protein encoded by this gene is a T cell-derived cytokine that shares sequence similarity with IL17. This cytokine was reported to stimulate the release of TNF alpha (TNF) and IL1 beta (IL1B) from a monocytic cell line. Immunohistochemical analysis of
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
9
Gene Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (9)
GO ID Ontology Definition Evidence Reference
GO:0005125 Function Cytokine activity IEA
GO:0005125 Function Cytokine activity TAS 10639155
GO:0005576 Component Extracellular region IEA
GO:0005615 Component Extracellular space IEA
GO:0006954 Process Inflammatory response IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
604627 5982 ENSG00000127743
Protein Protein information from UniProt database.
Gene Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9UHF5
Protein name Interleukin-17B (IL-17B) (Cytokine Zcyto7) (Interleukin-20) (IL-20) (Neuronal interleukin-17-related factor)
Protein function Stimulates the release of tumor necrosis factor alpha and IL-1-beta from the monocytic cell line THP-1.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF06083 IL17 96 → 179 Interleukin-17 Family
Tissue specificity TISSUE SPECIFICITY: Expressed in adult pancreas, small intestine, stomach, spinal cord and testis. Less pronounced expression in prostate, colon mucosal lining, and ovary.
Sequence 
MDWPHNLLFLLTISIFLGLGQPRSPKSKRKGQGRPGPLAPGPHQVPLDLVSRMKPYARME
EYERNIEEMVAQLRNSSELAQRKCEVNLQLWMSNKRSLSPWGYSINHDPSRIPVDLPEAR
CLCLGCVNPFTMQEDRSMVSVPVFSQVPVRRRLCPPPPRTGPCRQRAVMETIAVGCTCIF
Sequence length 180
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG 
  Cytokine-cytokine receptor interaction
IL-17 signaling pathway 		 
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
1
Gene Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (1)
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Keratoconus 1 Uncertain significance rs201298520 RCV000491934
Show/Hide Text Mining Associations (21)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Blister Associate 31572359
Breast Neoplasms Associate 34997107
Carcinogenesis Associate 33649532
Carcinoma Hepatocellular Inhibit 40544497
Carcinoma Squamous Cell Associate 31059089
Cataract Stimulate 32180680
Colorectal Neoplasms Associate 26304506
Depressive Disorder Major Associate 38297265
Gastrinoma Associate 38229586
Inflammation Associate 35013560