IL17C (interleukin 17C)

Gene
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
27189
Gene name Gene Name - the full gene name approved by the HGNC.
Interleukin 17C
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
IL17C
Synonyms (NCBI Gene) Gene synonyms aliases
CX2, IL-17C
Chromosome Chromosome number
16
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
16q24.2
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a T cell-derived cytokine that shares the sequence similarity with IL17. This cytokine was reported to stimulate the release of tumor necrosis factor alpha and interleukin 1 beta from a monocytic cell line. The expressi
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(6)
miRTarBase ID miRNA Experiments Reference
MIRT1063803 hsa-miR-365 CLIP-seq
MIRT1063804 hsa-miR-602 CLIP-seq
MIRT2389346 hsa-miR-1286 CLIP-seq
MIRT2389347 hsa-miR-4270 CLIP-seq
MIRT2389348 hsa-miR-4436a CLIP-seq
Transcription factors
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(2)
Transcription factor Regulation Reference
NFKB1 Activation 21628458
RELA Activation 21628458
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(7)
GO ID Ontology Definition Evidence Reference
GO:0005125 Function Cytokine activity IEA
GO:0005576 Component Extracellular region TAS
GO:0005615 Component Extracellular space IEA
GO:0006954 Process Inflammatory response IEA
GO:0007166 Process Cell surface receptor signaling pathway TAS 10639155
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
604628 5983 ENSG00000124391
Protein
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Q9P0M4
Protein name Interleukin-17C (IL-17C) (Cytokine CX2)
Protein function Cytokine that plays a crucial role in innate immunity of the epithelium, including to intestinal bacterial pathogens, in an autocrine manner. Stimulates the production of antibacterial peptides and pro-inflammatory molecules for host defense by
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF06083 IL17 104 → 192 Interleukin-17 Family
Sequence 
MTLLPGLLFLTWLHTCLAHHDPSLRGHPHSHGTPHCYSAEELPLGQAPPHLLARGAKWGQ
ALPVALVSSLEAASHRGRHERPSATTQCPVLRPEEVLEADTHQRSISPWRYRVDTDEDRY
PQKLAFAECLCRGCIDARTGRETAALNSVRLLQSLLVLRRRPCSRDGSGLPTPGAFAFHT
EFIHVPVGCTCVLPRSV
Sequence length 197
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  Cytokine-cytokine receptor interaction
IL-17 signaling pathway 		  Interleukin-17 signaling
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Schizophrenia Schizophrenia rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346
View all (12 more)		 10889554, 21688385
Show/Hide Text Mining Associations (47)
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 31059089
Arthritis Rheumatoid Associate 37926850
Atherosclerosis Associate 37173646
Bipolar Disorder Associate 38484669
Blister Associate 31572359
Brain Ischemia Stimulate 37173646
Carcinoma Adenoid Cystic Associate 33162788
Carcinoma Squamous Cell Associate 31059089
Colitis Ulcerative Stimulate 22994872
Colitis Ulcerative Associate 25526479