IL17C (interleukin 17C)

Gene Gene information from NCBI Gene database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID 27189
Gene name Interleukin 17C
Gene symbol IL17C
Synonyms (NCBI Gene)
CX2IL-17C
Chromosome 16
Chromosome location 16q24.2
Summary The protein encoded by this gene is a T cell-derived cytokine that shares the sequence similarity with IL17. This cytokine was reported to stimulate the release of tumor necrosis factor alpha and interleukin 1 beta from a monocytic cell line. The expressi
miRNA miRNA information provided by mirtarbase database.
6
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Show/Hide all (6)
miRTarBase ID miRNA Experiments Reference
MIRT1063803 hsa-miR-365 CLIP-seq
MIRT1063804 hsa-miR-602 CLIP-seq
MIRT2389346 hsa-miR-1286 CLIP-seq
MIRT2389347 hsa-miR-4270 CLIP-seq
MIRT2389348 hsa-miR-4436a CLIP-seq
Transcription factors Transcription factors information provided by TRRUST V2 database.
2
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Show/Hide all (2)
Transcription factor Regulation Reference
NFKB1 Activation 21628458
RELA Activation 21628458
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
10
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Show/Hide all (10)
GO ID Ontology Definition Evidence Reference
GO:0005125 Function Cytokine activity IEA
GO:0005125 Function Cytokine activity TAS 10639155
GO:0005576 Component Extracellular region IEA
GO:0005576 Component Extracellular region TAS
GO:0005615 Component Extracellular space IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
MIM HGNC e!Ensembl
604628 5983 ENSG00000124391
Protein Protein information from UniProt database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9P0M4
Protein name Interleukin-17C (IL-17C) (Cytokine CX2)
Protein function Cytokine that plays a crucial role in innate immunity of the epithelium, including to intestinal bacterial pathogens, in an autocrine manner. Stimulates the production of antibacterial peptides and pro-inflammatory molecules for host defense by
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF06083 IL17 104 → 192 Interleukin-17 Family
Sequence 
MTLLPGLLFLTWLHTCLAHHDPSLRGHPHSHGTPHCYSAEELPLGQAPPHLLARGAKWGQ
ALPVALVSSLEAASHRGRHERPSATTQCPVLRPEEVLEADTHQRSISPWRYRVDTDEDRY
PQKLAFAECLCRGCIDARTGRETAALNSVRLLQSLLVLRRRPCSRDGSGLPTPGAFAFHT
EFIHVPVGCTCVLPRSV
Sequence length 197
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
  KEGG  Reactome
  Cytokine-cytokine receptor interaction
IL-17 signaling pathway 		  Interleukin-17 signaling