IL37 (interleukin 37)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID 27178
Gene name Interleukin 37
Gene symbol IL37
Synonyms (NCBI Gene)
FIL1FIL1(ZETA)FIL1ZIL-1F7IL-1HIL-1H4IL-1RP1IL-23IL-37IL1F7IL1H4IL1RP1
Chromosome 2
Chromosome location 2q14.1
Summary The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine can bind to, and may be a ligand for interleukin 18 receptor (IL18R1/IL-1Rrp). This cytokine also binds to interleukin 18 binding protein (IL18BP), an inhibit
miRNA miRNA information provided by mirtarbase database.
1
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (1)
miRTarBase ID miRNA Experiments Reference
MIRT016962 hsa-miR-335-5p Microarray 18185580
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
32
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (32)
GO ID Ontology Definition Evidence Reference
GO:0005125 Function Cytokine activity IBA
GO:0005125 Function Cytokine activity IEA
GO:0005149 Function Interleukin-1 receptor binding IEA
GO:0005149 Function Interleukin-1 receptor binding NAS 10744718
GO:0005149 Function Interleukin-1 receptor binding TAS 10625660
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
605510 15563 ENSG00000125571
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9NZH6
Protein name Interleukin-37 (IL-37) (FIL1 zeta) (IL-1X) (Interleukin-1 family member 7) (IL-1F7) (Interleukin-1 homolog 4) (IL-1H) (IL-1H4) (Interleukin-1 zeta) (IL-1 zeta) (Interleukin-1-related protein) (IL-1RP1)
Protein function Immune regulatory cytokine that acts as a suppressor of innate inflammatory and immune responses involved in curbing excessive inflammation. Signaling can occur via two mechanisms, intracellularly through nuclear translocation with SMAD3 and ext
PDB 5HN1 , 6NCU
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00340 IL1 83 → 203 Interleukin-1 / 18 Domain
Tissue specificity TISSUE SPECIFICITY: In general, low constitutive expression, if any, in healthy tissues; high expression in inflammatory counterparts, including in synovial tissues from individuals with active rheumatoid arthritis. Isoform A, isoform B and isoform C are
Sequence 
MSFVGENSGVKMGSEDWEKDEPQCCLEDPAGSPLEPGPSLPTMNFVHTSPKVKNLNPKKF
SIHDQDHKVLVLDSGNLIAVPDKNYIRPEIFFALASSLSSASAEKGSPILLGVSKGEFCL
YCDKDKGQSHPSLQLKKEKLMKLAAQKESARRPFIFYRAQVGSWNMLESAAHPGWFICTS
CNCNEPVGVTDKFENRKHIEFSFQPVCKAEMSPSEVSD
Sequence length 218
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG  Reactome
  Cytokine-cytokine receptor interaction
Viral protein interaction with cytokine and cytokine receptor 		  Interleukin-37 signaling
Interleukin-18 signaling
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
2
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (1)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Inflammatory bowel disease Pathogenic rs750833867 RCV001527668
Show/Hide Unknown Diseases (1)
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Inflammatory bowel disease (infantile ulcerative colitis) 31, autosomal recessive Uncertain significance rs776169140 RCV003990444
Show/Hide Text Mining Associations (167)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Acidosis Renal Tubular Associate 31002145
Acute Coronary Syndrome Associate 25960620
Acute Coronary Syndrome Stimulate 28039466
Adenomyosis Inhibit 28762845
Alveolar Bone Loss Associate 31050915
Aneurysm Associate 35602104
Aortic Aneurysm Abdominal Inhibit 35602104
Arthralgia Associate 29566725
Arthritis Associate 25214710
Arthritis Gouty Associate 37853488