Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	27177
Gene name	Interleukin 36 beta
Gene symbol	IL36B
Synonyms (NCBI Gene)	FIL1FIL1-(ETA)FIL1HFILI-(ETA)IL-1F8IL-1H2IL1-ETAIL1F8IL1H2
Chromosome	2
Chromosome location	2q14.1
Summary	The protein encoded by this gene is a member of the interleukin 1 cytokine family. Protein structure modeling indicated that this cytokine may contain a 12-stranded beta-trefoil structure that is conserved between IL1A (IL-A alpha) and IL1B (IL-1 beta). T

Show/Hide all (33)

miRTarBase ID	miRNA	Experiments	Reference
MIRT621105	hsa-miR-1273f	HITS-CLIP	23824327
MIRT612034	hsa-miR-6716-5p	HITS-CLIP	23824327
MIRT612034	hsa-miR-6716-5p	HITS-CLIP	23824327
MIRT612034	hsa-miR-6716-5p	HITS-CLIP	23824327
MIRT612034	hsa-miR-6716-5p	HITS-CLIP	23824327
MIRT612034	hsa-miR-6716-5p	HITS-CLIP	23824327
MIRT621105	hsa-miR-1273f	HITS-CLIP	23824327
MIRT621104	hsa-miR-508-3p	HITS-CLIP	23824327
MIRT612034	hsa-miR-6716-5p	HITS-CLIP	23824327
MIRT621103	hsa-miR-6832-5p	HITS-CLIP	23824327
MIRT621102	hsa-miR-4732-5p	HITS-CLIP	23824327
MIRT612034	hsa-miR-6716-5p	HITS-CLIP	23824327
MIRT612034	hsa-miR-6716-5p	HITS-CLIP	23824327
MIRT621105	hsa-miR-1273f	HITS-CLIP	23824327
MIRT612034	hsa-miR-6716-5p	HITS-CLIP	23824327
MIRT612034	hsa-miR-6716-5p	HITS-CLIP	23824327
MIRT612034	hsa-miR-6716-5p	HITS-CLIP	23824327
MIRT612034	hsa-miR-6716-5p	HITS-CLIP	23824327
MIRT612034	hsa-miR-6716-5p	HITS-CLIP	23824327
MIRT621105	hsa-miR-1273f	HITS-CLIP	23824327
MIRT621104	hsa-miR-508-3p	HITS-CLIP	23824327
MIRT612034	hsa-miR-6716-5p	HITS-CLIP	23824327
MIRT621103	hsa-miR-6832-5p	HITS-CLIP	23824327
MIRT621102	hsa-miR-4732-5p	HITS-CLIP	23824327
MIRT612034	hsa-miR-6716-5p	HITS-CLIP	23824327
MIRT612034	hsa-miR-6716-5p	HITS-CLIP	23824327
MIRT1064926	hsa-miR-186	CLIP-seq
MIRT1064927	hsa-miR-3609	CLIP-seq
MIRT1064928	hsa-miR-3688-3p	CLIP-seq
MIRT1064929	hsa-miR-3978	CLIP-seq
MIRT1064930	hsa-miR-548ah	CLIP-seq
MIRT1922787	hsa-miR-3127-3p	CLIP-seq
MIRT1922788	hsa-miR-4691-5p	CLIP-seq

Show/Hide all (19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002376	Process	Immune system process	IEA
GO:0005125	Function	Cytokine activity	IBA
GO:0005125	Function	Cytokine activity	IEA
GO:0005149	Function	Interleukin-1 receptor binding	NAS	10744718
GO:0005149	Function	Interleukin-1 receptor binding	TAS	10625660
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS	10744718
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0006954	Process	Inflammatory response	IBA
GO:0006954	Process	Inflammatory response	IEA
GO:0006955	Process	Immune response	IBA
GO:0006955	Process	Immune response	IEA
GO:0006955	Process	Immune response	NAS	10744718
GO:0019221	Process	Cytokine-mediated signaling pathway	IBA
GO:0045087	Process	Innate immune response	IEA
GO:0045582	Process	Positive regulation of T cell differentiation	IBA
GO:0071222	Process	Cellular response to lipopolysaccharide	IBA

MIM	HGNC	e!Ensembl
605508	15564	ENSG00000136696

Q9NZH7

Protein name

Interleukin-36 beta (FIL1 eta) (Interleukin-1 eta) (IL-1 eta) (Interleukin-1 family member 8) (IL-1F8) (Interleukin-1 homolog 2) (IL-1H2)

Protein function

Cytokine that binds to and signals through the IL1RL2/IL-36R receptor which in turn activates NF-kappa-B and MAPK signaling pathways in target cells linked to a pro-inflammatory response. Part of the IL-36 signaling system that is thought to be

Family and domains

Tissue specificity

TISSUE SPECIFICITY: Expression at low levels in tonsil, bone marrow, heart, placenta, lung, testis and colon but not in any hematopoietic cell lines. Not detected in adipose tissue. Expressed at higher levels in psoriatic plaques than in symptomless psori

Sequence

MNPQREAAPKSYAIRDSRQMVWVLSGNSLIAAPLSRSIKPVTLHLIACRDTEFSDKEKGN
MVYLGIKGKDLCLFCAEIQGKPTLQLKLQGSQDNIGKDTCWKLVGIHTCINLDVRESCFM
GTLDQWGIGVGRKKWKSSFQHHHLRKKDKDFSSMRTNIGMPGRM

Sequence length

164

Interactions

View interactions

	KEGG		Reactome
	Cytokine-cytokine receptor interaction		Interleukin-36 pathway

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
High myopia	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-ALCOHOLIC FATTY LIVER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEVERE MYOPIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (11)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Arthritis Psoriatic	Associate	16918024	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Associate	32013927	★★★★★ ★☆☆☆☆ Found in Text Mining only
COVID 19	Associate	34987646	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Associate	37446281	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ichthyosis	Associate	29803800	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammation	Associate	33034926	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Associate	30643810	★★★★★ ★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Stimulate	33115414	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	32013927	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Associate	29803800	★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Tract Infections	Associate	34987646	★★★★★ ★☆☆☆☆ Found in Text Mining only

IL36B (interleukin 36 beta)