AGO2 (argonaute RISC catalytic component 2)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
27161
Gene name Gene Name - the full gene name approved by the HGNC.
Argonaute RISC catalytic component 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
AGO2
Synonyms (NCBI Gene) Gene synonyms aliases
CASC7, EIF2C2, LESKRES, LINC00980, PPD, Q10
Disease Acronyms (UniProt) Disease acronyms from UniProt database
LESKRES
Chromosome Chromosome number
8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
8q24.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the Argonaute family of proteins which play a role in RNA interference. The encoded protein is highly basic, and contains a PAZ domain and a PIWI domain. It may interact with dicer1 and play a role in short-interfering-RNA-me
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(2382)
miRTarBase ID miRNA Experiments Reference
MIRT007020 hsa-miR-376a-3p Luciferase reporter assay 21556037
MIRT007020 hsa-miR-376a-3p Luciferase reporter assay 21556037
MIRT007020 hsa-miR-376a-3p Luciferase reporter assay 21556037
MIRT024741 hsa-miR-215-5p Microarray 19074876
MIRT026680 hsa-miR-192-5p Microarray 19074876
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(74)
GO ID Ontology Definition Evidence Reference
GO:0000340 Function RNA 7-methylguanosine cap binding IDA 17524464
GO:0000932 Component P-body IDA 20616046, 22915799, 23125361
GO:0000993 Function RNA polymerase II complex binding IDA 25336585
GO:0001046 Function Core promoter sequence-specific DNA binding IMP 25336585
GO:0003723 Function RNA binding HDA 22658674, 22681889
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
606229 3263 ENSG00000123908
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Q9UKV8
Protein name Protein argonaute-2 (Argonaute2) (hAgo2) (EC 3.1.26.n2) (Argonaute RISC catalytic component 2) (Eukaryotic translation initiation factor 2C 2) (eIF-2C 2) (eIF2C 2) (PAZ Piwi domain protein) (PPD) (Protein slicer)
Protein function Required for RNA-mediated gene silencing (RNAi) by the RNA-induced silencing complex (RISC). The 'minimal RISC' appears to include AGO2 bound to a short guide RNA such as a microRNA (miRNA) or short interfering RNA (siRNA). These guide RNAs dire
PDB 3LUC , 3LUD , 3LUG , 3LUH , 3LUJ , 3LUK , 3QX8 , 3QX9 , 4F3T , 4OLA , 4OLB , 4W5N , 4W5O , 4W5Q , 4W5R , 4W5T , 4Z4C , 4Z4D , 4Z4E , 4Z4F , 4Z4G , 4Z4H , 4Z4I , 5JS1 , 5JS2 , 5KI6 , 5T7B , 5WEA , 6CBD , 6MDZ , 6MFN , 6MFR , 6N4O , 6NIT , 6RA4 , 7C6B , 7D7U , 7KI3 , 8D6J , 8D71 , 8THQ , 9BEZ , 9BF0 , 9BF2 , 9CMP
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF16486 ArgoN 36 → 166 N-terminal domain of argonaute Domain
PF08699 ArgoL1 176 → 226 Argonaute linker 1 domain Domain
PF02170 PAZ 231 → 365 PAZ domain Domain
PF16488 ArgoL2 374 → 420 Argonaute linker 2 domain Family
PF16487 ArgoMid 429 → 511 Mid domain of argonaute Domain
PF02171 Piwi 517 → 818 Piwi domain Family
Sequence 
MYSGAGPALAPPAPPPPIQGYAFKPPPRPDFGTSGRTIKLQANFFEMDIPKIDIYHYELD
IKPEKCPRRVNREIVEHMVQHFKTQIFGDRKPVFDGRKNLYTAMPLPIGRDKVELEVTLP
GEGKDRIFKVSIKWVSCVSLQALHDALSGRLPSVPFETIQALDVVMRHLPSMRYTPVGRS
FFTASEGCSNPLGGGREVWFGFHQSVRPSLWKMMLNIDVSATAFYKAQPVIEFVCEVLDF
KSIEEQQKPLTDSQRVKFTKEIKGLKVEITHCGQMKRKYRVCNVTRRPASHQTFPLQQES
GQTVECTVAQYFKDRHKLVLRYPHLPCLQVGQEQKHTYLPLEVCNIVAGQRCIKKLTDNQ
TSTMIRATARSAPDRQEEISKLMRSASFNTDPYVREFGIMVKDEMTDVTGRVLQPPSILY
GGRNKAIATPVQGVWDMRNKQFHTGIEIKVWAIACFAPQRQCTEVHLKSFTEQLRKISRD
AGMPIQGQPCFCKYAQGADSVEPMFRHLKNTYAGLQLVVVILPGKTPVYAEVKRVGDTVL
GMATQCVQMKNVQRTTPQTLSNLCLKINVKLGGVNNILLPQGRPPVFQQPVIFLGADVTH
PPAGDGKKPSIAAVVGSMDAHPNRYCATVRVQQHRQEIIQDLAAMVRELLIQFYKSTRFK
PTRIIFYRDGVSEGQFQQVLHHELLAIREACIKLEKDYQPGITFIVVQKRHHTRLFCTDK
NERVGKSGNIPAGTTVDTKITHPTEFDFYLCSHAGIQGTSRPSHYHVLWDDNRFSSDELQ
ILTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRARYHLVDKEHDSAEGSHTSGQSNGRDHQ
ALAKAVQVHQDTLRTMYFA
Sequence length 859
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  Reactome
    Pre-NOTCH Transcription and Translation
MicroRNA (miRNA) biogenesis
Ca2+ pathway
Small interfering RNA (siRNA) biogenesis
Post-transcriptional silencing by small RNAs
Transcriptional regulation by small RNAs
TP53 Regulates Metabolic Genes
MAPK6/MAPK4 signaling
Regulation of RUNX1 Expression and Activity
Regulation of PTEN mRNA translation
Competing endogenous RNAs (ceRNAs) regulate PTEN translation
Transcriptional Regulation by MECP2
Estrogen-dependent gene expression
NR1H3 & NR1H2 regulate gene expression linked to cholesterol transport and efflux
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Hypothyroidism Hypothyroidism rs869320723, rs121908862, rs121908863, rs121908865, rs121908866, rs121908867, rs121908870, rs121908871, rs121908872, rs2140110277, rs121908881, rs121908884, rs121908885, rs786205080, rs1586182912
View all (22 more)		 30595370
Show/Hide Unknown Diseases (3)
Unknown
Disease term Disease name Evidence References Source
Neuroticism Neuroticism GWAS
Dermatitis Dermatitis GWAS
Hypertension Hypertension GWAS
Show/Hide Text Mining Associations (78)
Associations from Text Mining
Disease Name Relationship Type References
Abnormalities Drug Induced Associate 27463019
Arthritis Rheumatoid Associate 2972742
Asthma Associate 32512817
Bone Diseases Associate 36454786
Brain Injuries Traumatic Associate 37889026
Breast Neoplasms Associate 18787018, 19723326, 22639842, 23636329, 23696926, 24398324, 24574065, 29941603, 30622242, 30999843, 31324173, 36613808, 37353728
Breast Neoplasms Stimulate 31280346
Breast Neoplasms Male Associate 33964913
Burkitt Lymphoma Associate 29458013
Carcinogenesis Associate 23411422, 24427355, 26545861, 30621629