Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	27128
Gene name	Cytohesin 4
Gene symbol	CYTH4
Synonyms (NCBI Gene)	CYT4DJ63G5.1PSCD4cytohesin-4
Chromosome	22
Chromosome location	22q13.1
Summary	This gene encodes a member of the PSCD family of proteins, which have an N-terminal coiled-coil motif, a central Sec7 domain, and a C-terminal pleckstrin homology (PH) domain. The coiled-coil motif is involved in homodimerization, the Sec7 domain contains

Show/Hide all (61)

miRTarBase ID	miRNA	Experiments	Reference
MIRT043285	hsa-miR-331-3p	CLASH	23622248
MIRT922308	hsa-miR-1	CLIP-seq
MIRT922309	hsa-miR-1470	CLIP-seq
MIRT922310	hsa-miR-206	CLIP-seq
MIRT922311	hsa-miR-3673	CLIP-seq
MIRT922312	hsa-miR-4446-5p	CLIP-seq
MIRT922313	hsa-miR-4480	CLIP-seq
MIRT922314	hsa-miR-4667-3p	CLIP-seq
MIRT922315	hsa-miR-4685-5p	CLIP-seq
MIRT922316	hsa-miR-4722-3p	CLIP-seq
MIRT922317	hsa-miR-4753-3p	CLIP-seq
MIRT922318	hsa-miR-4755-5p	CLIP-seq
MIRT922319	hsa-miR-4768-5p	CLIP-seq
MIRT922320	hsa-miR-613	CLIP-seq
MIRT922321	hsa-miR-642a	CLIP-seq
MIRT922322	hsa-miR-9	CLIP-seq
MIRT1547842	hsa-miR-3151	CLIP-seq
MIRT1973167	hsa-miR-1284	CLIP-seq
MIRT1973168	hsa-miR-1289	CLIP-seq
MIRT1973169	hsa-miR-149	CLIP-seq
MIRT1973170	hsa-miR-2355-5p	CLIP-seq
MIRT1973171	hsa-miR-24	CLIP-seq
MIRT1973172	hsa-miR-3064-5p	CLIP-seq
MIRT1973173	hsa-miR-3140-3p	CLIP-seq
MIRT1973174	hsa-miR-3157-5p	CLIP-seq
MIRT1973175	hsa-miR-3194-3p	CLIP-seq
MIRT1973176	hsa-miR-3198	CLIP-seq
MIRT1973177	hsa-miR-3202	CLIP-seq
MIRT1973178	hsa-miR-3670	CLIP-seq
MIRT1973179	hsa-miR-4252	CLIP-seq
MIRT1973180	hsa-miR-4284	CLIP-seq
MIRT1973181	hsa-miR-4294	CLIP-seq
MIRT1973182	hsa-miR-4297	CLIP-seq
MIRT1973183	hsa-miR-4309	CLIP-seq
MIRT1973184	hsa-miR-4533	CLIP-seq
MIRT1973185	hsa-miR-4691-3p	CLIP-seq
MIRT922319	hsa-miR-4768-5p	CLIP-seq
MIRT1973186	hsa-miR-4794	CLIP-seq
MIRT1973187	hsa-miR-4796-5p	CLIP-seq
MIRT1973169	hsa-miR-149	CLIP-seq
MIRT1973171	hsa-miR-24	CLIP-seq
MIRT1973172	hsa-miR-3064-5p	CLIP-seq
MIRT1973178	hsa-miR-3670	CLIP-seq
MIRT1973180	hsa-miR-4284	CLIP-seq
MIRT2208883	hsa-miR-4314	CLIP-seq
MIRT1973186	hsa-miR-4794	CLIP-seq
MIRT1973172	hsa-miR-3064-5p	CLIP-seq
MIRT2447969	hsa-miR-4254	CLIP-seq
MIRT2447970	hsa-miR-4292	CLIP-seq
MIRT2447971	hsa-miR-4308	CLIP-seq
MIRT2447972	hsa-miR-4487	CLIP-seq
MIRT2447973	hsa-miR-604	CLIP-seq
MIRT2447974	hsa-miR-647	CLIP-seq
MIRT2512645	hsa-miR-1825	CLIP-seq
MIRT2512646	hsa-miR-34c-3p	CLIP-seq
MIRT2512647	hsa-miR-520f	CLIP-seq
MIRT2512648	hsa-miR-636	CLIP-seq
MIRT2512645	hsa-miR-1825	CLIP-seq
MIRT2512646	hsa-miR-34c-3p	CLIP-seq
MIRT2512647	hsa-miR-520f	CLIP-seq
MIRT2512648	hsa-miR-636	CLIP-seq

Show/Hide all (15)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IEA
GO:0000139	Component	Golgi membrane	TAS
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	IBA
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	IDA	10652308
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	IEA
GO:0005515	Function	Protein binding	IPI	31515488, 32296183, 33961781
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IDA	17398095
GO:0005886	Component	Plasma membrane	IEA
GO:0008289	Function	Lipid binding	IEA
GO:0016020	Component	Membrane	IEA
GO:0032012	Process	Regulation of ARF protein signal transduction	IEA
GO:0034451	Component	Centriolar satellite	IDA
GO:0045171	Component	Intercellular bridge	IDA

MIM	HGNC	e!Ensembl
606514	9505	ENSG00000100055

Q9UIA0

Protein name

Cytohesin-4 (PH, SEC7 and coiled-coil domain-containing protein 4)

Protein function

Promotes guanine-nucleotide exchange on ARF1 and ARF5. Promotes the activation of ARF factors through replacement of GDP with GTP.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01369	Sec7	61 → 243	Sec7 domain	Domain
PF00169	PH	260 → 375	PH domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed predominantly in peripheral blood leukocytes. {ECO:0000269|PubMed:10652308}.

Sequence

MDLCHPEPAELSSGETEELQRIKWHRKQLLEDIQKLKDEIADVFAQIDCFESAEESRMAQ
KEKELCIGRKKFNMDPAKGIQYFIEHKLLTPDVQDIARFLYKGEGLNKTAIGTYLGERDP
INLQVLQAFVDCHEFANLNLVQALRQFLWSFRLPGEAQKIDRMMEAFATRYCLCNPGVFQ
STDTCYVLSFSIIMLNTSLHNPNVRDRPPFERFVSMNRGINNGSDLPEDQLRNLFDSIKS
EPFSIPEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEFTTDKEPR
GIIPLENLSVQKVDDPKKPFCLELYNPSCRGQKIKACKTDGDGRVVEGKHESYRISATSA
EERDQWIESIRASITRVPFYDLVSTRKKKIASKQ

Sequence length

394

Interactions

View interactions

	KEGG		Reactome
	Phospholipase D signaling pathway Endocytosis Pathogenic Escherichia coli infection Shigellosis Salmonella infection		Intra-Golgi traffic

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Clear cell carcinoma of kidney	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EBV-positive nodal T- and NK-cell lymphoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
JUVENILE IDIOPATHIC ARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UTERINE FIBROID	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (5)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Celiac Disease	Associate	31591516	★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Associate	36982982	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leiomyoma	Associate	28836065	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	33078956	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Stimulate	33078956	★★★★★ ★☆☆☆☆ Found in Text Mining only

CYTH4 (cytohesin 4)