Gene Gene information from NCBI Gene database.
Entrez ID 27122
Gene name Dickkopf Wnt signaling pathway inhibitor 3
Gene symbol DKK3
Synonyms (NCBI Gene)
CRRLREICRIG
Chromosome 11
Chromosome location 11p15.3
Summary This gene encodes a protein that is a member of the dickkopf family. The secreted protein contains two cysteine rich regions and is involved in embryonic development through its interactions with the Wnt signaling pathway. The expression of this gene is d
miRNA miRNA information provided by mirtarbase database.
309
miRTarBase ID miRNA Experiments Reference
MIRT053048 hsa-miR-183-5p ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot 23538390
MIRT438225 hsa-miR-92b-3p Luciferase reporter assayWestern blot 24325785
MIRT438225 hsa-miR-92b-3p Luciferase reporter assayWestern blot 24325785
MIRT438225 hsa-miR-92b-3p Luciferase reporter assayWestern blot 24325785
MIRT438225 hsa-miR-92b-3p Luciferase reporter assayWestern blot 24325785
Transcription factors Transcription factors information provided by TRRUST V2 database.
1
Transcription factor Regulation Reference
MYCN Repression 18059033;21796614
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
18
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183, 32814053
GO:0005576 Component Extracellular region IEA
GO:0005615 Component Extracellular space IBA
GO:0005615 Component Extracellular space TAS 10570958
GO:0009653 Process Anatomical structure morphogenesis TAS 10570958
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
605416 2893 ENSG00000050165
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9UBP4
Protein name Dickkopf-related protein 3 (Dickkopf-3) (Dkk-3) (hDkk-3)
Protein function Antagonizes canonical Wnt signaling by inhibiting LRP5/6 interaction with Wnt and by forming a ternary complex with the transmembrane protein KREMEN that promotes internalization of LRP5/6. DKKs play an important role in vertebrate development,
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04706 Dickkopf_N 146 196 Dickkopf N-terminal cysteine-rich region Family
Tissue specificity TISSUE SPECIFICITY: Highest expression in heart, brain, and spinal cord. {ECO:0000269|PubMed:10570958, ECO:0000269|Ref.4}.
Sequence
MQRLGATLLCLLLAAAVPTAPAPAPTATSAPVKPGPALSYPQEEATLNEMFREVEELMED
TQHKLRSAVEEMEAEEAAAKASSEVNLANLPPSYHNETNTDTKVGNNTIHVHREIHKITN
NQTGQMVFSETVITSVGDEEGRRSHECIIDEDCGPSMYCQFASFQYTCQPCRGQRMLCTR
DSECCGDQLCVWGHCT
KMATRGSNGTICDNQRDCQPGLCCAFQRGLLFPVCTPLPVEGEL
CHDPASRLLDLITWELEPDGALDRCPCASGLLCQPHSHSLVYVCKPTFVGSRDQDGEILL
PREVPDEYEVGSFMEEVRQELEDLERSLTEEMALREPAAAAAALLGGEEI
Sequence length 350
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
6
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Autosomal dominant polycystic liver disease Likely pathogenic rs2134978784, rs201778105 RCV001844920
RCV001844921
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Autosomal dominant polycystic kidney disease Uncertain significance rs199563886, rs114429255 RCV001844917
RCV001844918
Marfanoid habitus and intellectual disability Uncertain significance rs1590500384 RCV000850437
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Adenoma Associate 24350795, 28058013
Adrenal Cortex Diseases Associate 28249601
Adrenocortical Carcinoma Inhibit 28249601
Aicardi Syndrome Inhibit 28249601
Alzheimer Disease Stimulate 19457090
Alzheimer Disease Associate 26119087, 35962130
Atrial Fibrillation Associate 32809235, 34798808
Breast Neoplasms Inhibit 18826564, 27467270
Breast Neoplasms Associate 19570204, 23320751, 23516639, 23890219, 29843219, 30154364, 33462997, 36869893
Bronchiolitis Obliterans Syndrome Associate 32492155