Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
27122
Gene name Gene Name - the full gene name approved by the HGNC.
Dickkopf Wnt signaling pathway inhibitor 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
DKK3
Synonyms (NCBI Gene) Gene synonyms aliases
CRRL, REIC, RIG
Chromosome Chromosome number
11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
11p15.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a protein that is a member of the dickkopf family. The secreted protein contains two cysteine rich regions and is involved in embryonic development through its interactions with the Wnt signaling pathway. The expression of this gene is d
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT053048 hsa-miR-183-5p Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot 23538390
MIRT438225 hsa-miR-92b-3p Luciferase reporter assay, Western blot 24325785
MIRT438225 hsa-miR-92b-3p Luciferase reporter assay, Western blot 24325785
MIRT438225 hsa-miR-92b-3p Luciferase reporter assay, Western blot 24325785
MIRT438225 hsa-miR-92b-3p Luciferase reporter assay, Western blot 24325785
Transcription factors
Transcription factor Regulation Reference
MYCN Repression 18059033;21796614
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183, 32814053
GO:0005615 Component Extracellular space IBA 21873635
GO:0009653 Process Anatomical structure morphogenesis TAS 10570958
GO:0016055 Process Wnt signaling pathway IEA
GO:0017015 Process Regulation of transforming growth factor beta receptor signaling pathway NAS 24431302
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
605416 2893 ENSG00000050165
Protein
UniProt ID Q9UBP4
Protein name Dickkopf-related protein 3 (Dickkopf-3) (Dkk-3) (hDkk-3)
Protein function Antagonizes canonical Wnt signaling by inhibiting LRP5/6 interaction with Wnt and by forming a ternary complex with the transmembrane protein KREMEN that promotes internalization of LRP5/6. DKKs play an important role in vertebrate development,
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04706 Dickkopf_N 146 196 Dickkopf N-terminal cysteine-rich region Family
Tissue specificity TISSUE SPECIFICITY: Highest expression in heart, brain, and spinal cord. {ECO:0000269|PubMed:10570958, ECO:0000269|Ref.4}.
Sequence
MQRLGATLLCLLLAAAVPTAPAPAPTATSAPVKPGPALSYPQEEATLNEMFREVEELMED
TQHKLRSAVEEMEAEEAAAKASSEVNLANLPPSYHNETNTDTKVGNNTIHVHREIHKITN
NQTGQMVFSETVITSVGDEEGRRSHECIIDEDCGPSMYCQFASFQYTCQPCRGQRMLCTR
DSECCGDQLCVWGHCT
KMATRGSNGTICDNQRDCQPGLCCAFQRGLLFPVCTPLPVEGEL
CHDPASRLLDLITWELEPDGALDRCPCASGLLCQPHSHSLVYVCKPTFVGSRDQDGEILL
PREVPDEYEVGSFMEEVRQELEDLERSLTEEMALREPAAAAAALLGGEEI
Sequence length 350
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Rheumatoid arthritis Rheumatoid Arthritis rs587776843 22491018
Schizophrenia Schizophrenia rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346
View all (12 more)
15998302
Unknown
Disease term Disease name Evidence References Source
Breast cancer Breast cancer Importantly, breast cancer patients bearing PRC2 LOF mutations displayed significantly worse prognosis compared with PRC2 wild-type patients GWAS, CBGDA
Associations from Text Mining
Disease Name Relationship Type References
Adenoma Associate 24350795, 28058013
Adrenal Cortex Diseases Associate 28249601
Adrenocortical Carcinoma Inhibit 28249601
Aicardi Syndrome Inhibit 28249601
Alzheimer Disease Stimulate 19457090
Alzheimer Disease Associate 26119087, 35962130
Atrial Fibrillation Associate 32809235, 34798808
Breast Neoplasms Inhibit 18826564, 27467270
Breast Neoplasms Associate 19570204, 23320751, 23516639, 23890219, 29843219, 30154364, 33462997, 36869893
Bronchiolitis Obliterans Syndrome Associate 32492155