DKKL1 (dickkopf like acrosomal protein 1)

Gene
Gene Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
27120
Gene name Gene Name - the full gene name approved by the HGNC.
Dickkopf like acrosomal protein 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
DKKL1
Synonyms (NCBI Gene) Gene synonyms aliases
CT34, SGY, SGY-1, SGY1
Chromosome Chromosome number
19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
19q13.33
Summary Summary of gene provided in NCBI Entrez Gene.
The dickkopf protein family interacts with the Wnt signaling pathway and its members are characterized by two conserved cysteine-rich domains. This gene encodes a secreted protein that has low sequence similarity to the dickkopf-3 protein. Multiple altern
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene Gene ontology Other IDs Protein Associated diseases
Show/Hide all(11)
GO ID Ontology Definition Evidence Reference
GO:0001669 Component Acrosomal vesicle ISS
GO:0005615 Component Extracellular space IBA 21873635
GO:0007341 Process Penetration of zona pellucida ISS
GO:0009653 Process Anatomical structure morphogenesis TAS 10570958
GO:0039706 Function Co-receptor binding IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
605418 16528 ENSG00000104901
Protein
Gene Gene ontology Other IDs Protein Associated diseases
UniProt ID Q9UK85
Protein name Dickkopf-like protein 1 (Cancer/testis antigen 34) (CT34) (Protein soggy-1) (SGY-1)
Protein function Involved in fertilization by facilitating sperm penetration of the zona pellucida. May promote spermatocyte apoptosis, thereby limiting sperm production. In adults, may reduce testosterone synthesis in Leydig cells. Is not essential either for d
Family and domains
Tissue specificity TISSUE SPECIFICITY: More highly expressed in adult testis than in fetal testis. Exclusively expressed in the testis (at protein level). Intense expression in stages II, III and IV of spermatogenesis, whereas expression is lower in stage I. {ECO:0000269|Pu
Sequence 
MGEASPPAPARRHLLVLLLLLSTLVIPSAAAPIHDADAQESSLGLTGLQSLLQGFSRLFL
KGNLLRGIDSLFSAPMDFRGLPGNYHKEENQEHQLGNNTLSSHLQIDKMTDNKTGEVLIS
ENVVASIQPAEGSFEGDLKVPRMEEKEALVPIQKATDSFHTELHPRVAFWIIKLPRRRSH
QDALEGGHWLSEKRHRLQAIRDGLRKGTHKDVLEEGTESSSHSRLSPRKTHLLYILRPSR
QL
Sequence length 242
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene Gene ontology Other IDs Protein Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Multiple sclerosis Multiple Sclerosis rs104895219, rs483353022, rs483353023, rs483353028, rs483353029, rs483353024, rs483353030, rs3207617, rs483353031, rs483353032, rs483353033, rs483353034, rs483353035, rs483353036, rs483353039
View all (4 more)		 24076602, 21833088
Show/Hide Unknown Diseases (1)
Unknown
Disease term Disease name Evidence References Source
Multiple Sclerosis Multiple Sclerosis GWAS
Show/Hide Text Mining Associations (2)
Associations from Text Mining
Disease Name Relationship Type References
Neoplasms Associate 27635108
Squamous Cell Carcinoma of Head and Neck Associate 33281184