Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	27120
Gene name Gene Name - the full gene name approved by the HGNC.	Dickkopf like acrosomal protein 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	DKKL1
Synonyms (NCBI Gene) Gene synonyms aliases	CT34, SGY, SGY-1, SGY1
Chromosome Chromosome number	19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	19q13.33
Summary Summary of gene provided in NCBI Entrez Gene.	The dickkopf protein family interacts with the Wnt signaling pathway and its members are characterized by two conserved cysteine-rich domains. This gene encodes a secreted protein that has low sequence similarity to the dickkopf-3 protein. Multiple altern

Show/Hide all(18)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001669	Component	Acrosomal vesicle	IEA
GO:0001669	Component	Acrosomal vesicle	ISS
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	TAS	10570958
GO:0007341	Process	Penetration of zona pellucida	IEA
GO:0007341	Process	Penetration of zona pellucida	ISS
GO:0009653	Process	Anatomical structure morphogenesis	TAS	10570958
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0039706	Function	Co-receptor binding	IBA
GO:0043065	Process	Positive regulation of apoptotic process	IEA
GO:0043065	Process	Positive regulation of apoptotic process	ISS
GO:0045600	Process	Positive regulation of fat cell differentiation	IEA
GO:0048019	Function	Receptor antagonist activity	IBA
GO:0060070	Process	Canonical Wnt signaling pathway	IEA
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IBA
GO:2000225	Process	Negative regulation of testosterone biosynthetic process	IEA
GO:2000225	Process	Negative regulation of testosterone biosynthetic process	ISS

MIM	HGNC	e!Ensembl
605418	16528	ENSG00000104901

Protein

UniProt ID

Q9UK85

Protein name

Dickkopf-like protein 1 (Cancer/testis antigen 34) (CT34) (Protein soggy-1) (SGY-1)

Protein function

Involved in fertilization by facilitating sperm penetration of the zona pellucida. May promote spermatocyte apoptosis, thereby limiting sperm production. In adults, may reduce testosterone synthesis in Leydig cells. Is not essential either for d

Family and domains

Tissue specificity

TISSUE SPECIFICITY: More highly expressed in adult testis than in fetal testis. Exclusively expressed in the testis (at protein level). Intense expression in stages II, III and IV of spermatogenesis, whereas expression is lower in stage I. {ECO:0000269|Pu

Sequence

MGEASPPAPARRHLLVLLLLLSTLVIPSAAAPIHDADAQESSLGLTGLQSLLQGFSRLFL
KGNLLRGIDSLFSAPMDFRGLPGNYHKEENQEHQLGNNTLSSHLQIDKMTDNKTGEVLIS
ENVVASIQPAEGSFEGDLKVPRMEEKEALVPIQKATDSFHTELHPRVAFWIIKLPRRRSH
QDALEGGHWLSEKRHRLQAIRDGLRKGTHKDVLEEGTESSSHSRLSPRKTHLLYILRPSR
QL

Sequence length

242

Interactions

View interactions

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Multiple Sclerosis	Multiple sclerosis	N/A	N/A	GWAS

Show/Hide Text Mining Associations (2)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Neoplasms	Associate	27635108
Squamous Cell Carcinoma of Head and Neck	Associate	33281184

DKKL1 (dickkopf like acrosomal protein 1)