GJB5 (gap junction protein beta 5)

Gene

• Entrez ID: 2709
• Gene name: Gap junction protein beta 5
• Gene symbol: GJB5
• Synonyms (NCBI Gene): CX31.1
• Chromosome: 1
• Chromosome location: 1p34.3
• Summary: This gene encodes a member of the beta-type (group I) connexin family. The encoded protein is a gap junction protein involved in intercellular communication related to epidermal differentiation and environmental sensing. This gene has been linked to non-s

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT019030	hsa-miR-335-5p	Microarray	18185580

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005243	Function	Gap junction channel activity	IBA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005886	Component	Plasma membrane	IEA
GO:0005921	Component	Gap junction	IEA
GO:0005922	Component	Connexin complex	IBA
GO:0005922	Component	Connexin complex	IEA
GO:0007154	Process	Cell communication	IEA
GO:0007267	Process	Cell-cell signaling	IBA
GO:0008544	Process	Epidermis development	TAS	9843209
GO:0016020	Component	Membrane	IEA
GO:0055085	Process	Transmembrane transport	IEA
GO:0060707	Process	Trophoblast giant cell differentiation	IEA
GO:0060713	Process	Labyrinthine layer morphogenesis	IEA
GO:0070161	Component	Anchoring junction	IEA

Other IDs

• MIM: 604493
• HGNC: 4287
• e!Ensembl: ENSG00000189280

Protein

• UniProt ID: O95377
• Protein name: Gap junction beta-5 protein (Connexin-31.1) (Cx31.1)
• Protein function: One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00029	Connexin	2 → 210	Connexin	Family

• Sequence:

  MNWSIFEGLLSGVNKYSTAFGRIWLSLVFIFRVLVYLVTAERVWSDDHKDFDCNTRQPGC
  SNVCFDEFFPVSHVRLWALQLILVTCPSLLVVMHVAYREVQEKRHREAHGENSGRLYLNP
  GKKRGGLWWTYVCSLVFKASVDIAFLYVFHSFYPKYILPPVVKCHADPCPNIVDCFISKP
  SEKNIFTLFMVATAAICILLNLVELIYLVSKRCHECLAARKAQAMCTGHHPHGTTSSCKQ
  DDLLSGDLIFLGSDSHPPLLPDRPRDHVKKTIL

• Sequence length: 273

Pathways

Reactome:

Gap junction assembly