Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	2709
Gene name Gene Name - the full gene name approved by the HGNC.	Gap junction protein beta 5
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	GJB5
Synonyms (NCBI Gene) Gene synonyms aliases	CX31.1
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1p34.3
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the beta-type (group I) connexin family. The encoded protein is a gap junction protein involved in intercellular communication related to epidermal differentiation and environmental sensing. This gene has been linked to non-s

Show/Hide all(1)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019030	hsa-miR-335-5p	Microarray	18185580

Show/Hide all(14)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005243	Function	Gap junction channel activity	IBA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005886	Component	Plasma membrane	IEA
GO:0005921	Component	Gap junction	IEA
GO:0005922	Component	Connexin complex	IBA
GO:0005922	Component	Connexin complex	IEA
GO:0007154	Process	Cell communication	IEA
GO:0007267	Process	Cell-cell signaling	IBA
GO:0008544	Process	Epidermis development	TAS	9843209
GO:0016020	Component	Membrane	IEA
GO:0055085	Process	Transmembrane transport	IEA
GO:0060707	Process	Trophoblast giant cell differentiation	IEA
GO:0060713	Process	Labyrinthine layer morphogenesis	IEA
GO:0070161	Component	Anchoring junction	IEA

MIM	HGNC	e!Ensembl
604493	4287	ENSG00000189280

Protein

UniProt ID

O95377

Protein name

Gap junction beta-5 protein (Connexin-31.1) (Cx31.1)

Protein function

One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00029	Connexin	2 → 210	Connexin	Family

Sequence

MNWSIFEGLLSGVNKYSTAFGRIWLSLVFIFRVLVYLVTAERVWSDDHKDFDCNTRQPGC
SNVCFDEFFPVSHVRLWALQLILVTCPSLLVVMHVAYREVQEKRHREAHGENSGRLYLNP
GKKRGGLWWTYVCSLVFKASVDIAFLYVFHSFYPKYILPPVVKCHADPCPNIVDCFISKP
SEKNIFTLFMVATAAICILLNLVELIYLVSKRCHECLAARKAQAMCTGHHPHGTTSSCKQ
DDLLSGDLIFLGSDSHPPLLPDRPRDHVKKTIL

Sequence length

273

Interactions

View interactions

	Reactome
			Gap junction assembly

GJB5 (gap junction protein beta 5)