Gene Gene information from NCBI Gene database.
Entrez ID 27074
Gene name Lysosomal associated membrane protein 3
Gene symbol LAMP3
Synonyms (NCBI Gene)
CD208DC LAMPDC-LAMPDCLAMPLAMPLAMP-3TSC403
Chromosome 3
Chromosome location 3q27.1
Summary Dendritic cells (DCs) are the most potent antigen-presenting cells. Immature DCs efficiently capture antigens and differentiate into interdigitating dendritic cells (IDCs) in lymphoid tissues that induce primary T-cell responses (summary by de Saint-Vis e
miRNA miRNA information provided by mirtarbase database.
178
miRTarBase ID miRNA Experiments Reference
MIRT029868 hsa-miR-26b-5p Microarray 19088304
MIRT702304 hsa-miR-6771-3p HITS-CLIP 23313552
MIRT702305 hsa-miR-369-3p HITS-CLIP 23313552
MIRT702303 hsa-miR-5692b HITS-CLIP 23313552
MIRT702302 hsa-miR-5692c HITS-CLIP 23313552
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
27
GO ID Ontology Definition Evidence Reference
GO:0002250 Process Adaptive immune response IEA
GO:0002376 Process Immune system process IEA
GO:0005764 Component Lysosome IEA
GO:0005765 Component Lysosomal membrane IBA
GO:0005765 Component Lysosomal membrane IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
605883 14582 ENSG00000078081
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9UQV4
Protein name Lysosome-associated membrane glycoprotein 3 (LAMP-3) (Lysosomal-associated membrane protein 3) (DC-lysosome-associated membrane glycoprotein) (DC LAMP) (Protein TSC403) (CD antigen CD208)
Protein function Lysosomal membrane glycoprotein which plays a role in the unfolded protein response (UPR) that contributes to protein degradation and cell survival during proteasomal dysfunction (PubMed:25681212). Plays a role in the process of fusion of the ly
PDB 4AKM
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01299 Lamp 223 366 Lysosome-associated membrane glycoprotein (Lamp) Family
Tissue specificity TISSUE SPECIFICITY: Detected in tonsil interdigitating dendritic cells, in spleen, lymph node, Peyer's patches in the small instestine, in thymus medulla and in B-cells (at protein level). Expressed in lymphoid organs and dendritic cells. Expressed in lun
Sequence
MPRQLSAAAALFASLAVILHDGSQMRAKAFPETRDYSQPTAAATVQDIKKPVQQPAKQAP
HQTLAARFMDGHITFQTAATVKIPTTTPATTKNTATTSPITYTLVTTQATPNNSHTAPPV
TEVTVGPSLAPYSLPPTITPPAHTTGTSSSTVSHTTGNTTQPSNQTTLPATLSIALHKST
TGQKPVQPTHAPGTTAAAHNTTRTAAPASTVPGPTLAPQPSSVKTGIYQVLNGSRLCIKA
EMGIQLIVQDKESVFSPRRYFNIDPNATQASGNCGTRKSNLLLNFQGGFVNLTFTKDEES
YYISEVGAYLTVSDPETIYQGIKHAVVMFQTAVGHSFKCVSEQSLQLSAHLQVKTTDVQL
QAFDFE
DDHFGNVDECSSDYTIVLPVIGAIVVGLCLMGMGVYKIRLRCQSSGYQRI
Sequence length 416
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG 
  Lysosome  
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
1
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
See cases Uncertain significance rs770560672 RCV003388301
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Acute Coronary Syndrome Associate 34753383
Adenocarcinoma of Lung Associate 34580602
Arthritis Rheumatoid Associate 18292234
Bipolar Disorder Associate 27759212
Breast Neoplasms Associate 20678512, 23294542, 37747033
Breast Neoplasms Stimulate 28607528
Buschke Lowenstein Tumor Associate 23569139
Carcinoma Intraductal Noninfiltrating Associate 37373062
Clinical Deterioration Stimulate 25997515
Colorectal Neoplasms Associate 11485903, 25362357