Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
27068
Gene name Gene Name - the full gene name approved by the HGNC.
Inorganic pyrophosphatase 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PPA2
Synonyms (NCBI Gene) Gene synonyms aliases
HSPC124, SCFAI, SCFI, SID6-306
Chromosome Chromosome number
4
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
4q24
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is localized to the mitochondrion, is highly similar to members of the inorganic pyrophosphatase (PPase) family, and contains the signature sequence essential for the catalytic activity of PPase. PPases catalyze the hydrol
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs138215926 G>A Pathogenic Missense variant, coding sequence variant
rs139076647 C>A,T Likely-pathogenic Missense variant, coding sequence variant, intron variant
rs146013446 C>T Likely-pathogenic, pathogenic Missense variant, intron variant, coding sequence variant
rs151331559 G>A,C,T Pathogenic, likely-pathogenic Coding sequence variant, missense variant, stop gained
rs546693824 G>A Pathogenic Missense variant, intron variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT016388 hsa-miR-193b-3p Proteomics 21512034
MIRT023639 hsa-miR-1-3p Proteomics 18668040
MIRT1251165 hsa-miR-4677-3p CLIP-seq
MIRT1251166 hsa-miR-4679 CLIP-seq
MIRT1251167 hsa-miR-3074-3p CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000287 Function Magnesium ion binding IEA
GO:0004427 Function Inorganic diphosphate phosphatase activity IBA
GO:0004427 Function Inorganic diphosphate phosphatase activity IDA 27523597
GO:0004427 Function Inorganic diphosphate phosphatase activity IEA
GO:0004722 Function Protein serine/threonine phosphatase activity IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
609988 28883 ENSG00000138777
Protein
UniProt ID Q9H2U2
Protein name Inorganic pyrophosphatase 2, mitochondrial (EC 3.6.1.1) (Pyrophosphatase SID6-306) (Pyrophosphate phospho-hydrolase 2) (PPase 2)
Protein function Hydrolyzes inorganic pyrophosphate (PubMed:27523597). This activity is essential for correct regulation of mitochondrial membrane potential, and mitochondrial organization and function (PubMed:27523598). {ECO:0000269|PubMed:27523597, ECO:0000269
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00719 Pyrophosphatase 94 276 Inorganic pyrophosphatase Domain
Tissue specificity TISSUE SPECIFICITY: Detected in brain, gastric carcinoma, lung, ovary, skeletal muscle, umbilical cord blood and a cell line derived from kidney proximal tubule epithelium. {ECO:0000269|PubMed:15210126}.
Sequence
MSALLRLLRTGAPAAACLRLGTSAGTGSRRAMALYHTEERGQPCSQNYRLFFKNVTGHYI
SPFHDIPLKVNSKEENGIPMKKARNDEYENLFNMIVEIPRWTNAKMEIATKEPMNPIKQY
VKDGKLRYVANIFPYKGYIWNYGTLPQTWEDPHEKDKSTNCFGDNDPIDVCEIGSKILSC
GEVIHVKILGILALIDEGETDWKLIAINANDPEASKFHDIDDVKKFKPGYLEATLNWFRL
YKVPDGKPENQFAFNGEFKNKAFALEVIKSTHQCWK
ALLMKKCNGGAINCTNVQISDSPF
RCTQEEARSLVESVSSSPNKESNEEEQVWHFLGK
Sequence length 334
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Oxidative phosphorylation   Mitochondrial tRNA aminoacylation
Pyrophosphate hydrolysis
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
SUDDEN CARDIAC FAILURE sudden cardiac failure, infantile rs146013446, rs1057517679, rs1057517680, rs138215926, rs546693824, rs1187924642, rs772083375, rs1057517678 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Breast Cancer Breast cancer N/A N/A GWAS
Insomnia Insomnia N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Breast Neoplasms Associate 26354892, 39176095
Cardiomyopathies Associate 31705601, 34400813, 38582264
Death Associate 31705601
Death Sudden Associate 31705601, 38582264
Death Sudden Cardiac Associate 27523598, 33028643, 34400813, 38582264
Disease Associate 38582264
Heart Arrest Associate 27523598, 37269378, 38582264
Heart Diseases Associate 34400813
Heart Failure Associate 34400813
Hypertension Associate 33028643