Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	27065
Gene name Gene Name - the full gene name approved by the HGNC.	Neuronal vesicle trafficking associated 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	NSG1
Synonyms (NCBI Gene) Gene synonyms aliases	D4S234, D4S234E, NEEP21, P21
Chromosome Chromosome number	4
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	4p16.3

Show/Hide all(21)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016351	hsa-miR-193b-3p	Microarray	20304954
MIRT721176	hsa-miR-3918	HITS-CLIP	19536157
MIRT721174	hsa-miR-4685-5p	HITS-CLIP	19536157
MIRT721175	hsa-miR-6837-5p	HITS-CLIP	19536157
MIRT721173	hsa-miR-1915-3p	HITS-CLIP	19536157
MIRT721171	hsa-miR-6764-5p	HITS-CLIP	19536157
MIRT721172	hsa-miR-340-3p	HITS-CLIP	19536157
MIRT721170	hsa-miR-6827-3p	HITS-CLIP	19536157
MIRT721168	hsa-miR-6515-3p	HITS-CLIP	19536157
MIRT721169	hsa-miR-1236-3p	HITS-CLIP	19536157
MIRT721167	hsa-miR-7977	HITS-CLIP	19536157
MIRT721176	hsa-miR-3918	HITS-CLIP	19536157
MIRT721174	hsa-miR-4685-5p	HITS-CLIP	19536157
MIRT721175	hsa-miR-6837-5p	HITS-CLIP	19536157
MIRT721173	hsa-miR-1915-3p	HITS-CLIP	19536157
MIRT721171	hsa-miR-6764-5p	HITS-CLIP	19536157
MIRT721172	hsa-miR-340-3p	HITS-CLIP	19536157
MIRT721170	hsa-miR-6827-3p	HITS-CLIP	19536157
MIRT721168	hsa-miR-6515-3p	HITS-CLIP	19536157
MIRT721169	hsa-miR-1236-3p	HITS-CLIP	19536157
MIRT721167	hsa-miR-7977	HITS-CLIP	19536157

Show/Hide all(37)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001881	Process	Receptor recycling	ISS
GO:0001921	Process	Positive regulation of receptor recycling	IEA
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005515	Function	Protein binding	IPI	25416956, 30312582, 32296183
GO:0005634	Component	Nucleus	TAS	9013775
GO:0005737	Component	Cytoplasm	TAS	9013775
GO:0005768	Component	Endosome	IBA	21873635
GO:0005768	Component	Endosome	ISS
GO:0005770	Component	Late endosome	ISS
GO:0005783	Component	Endoplasmic reticulum	IDA	20599942
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0006915	Process	Apoptotic process	IMP	20599942
GO:0007212	Process	Dopamine receptor signaling pathway	IEA
GO:0016021	Component	Integral component of membrane	IBA	21873635
GO:0016197	Process	Endosomal transport	IBA	21873635
GO:0016328	Component	Lateral plasma membrane	IEA
GO:0030425	Component	Dendrite	ISS
GO:0030659	Component	Cytoplasmic vesicle membrane	IEA
GO:0031901	Component	Early endosome membrane	ISS
GO:0032051	Function	Clathrin light chain binding	IBA	21873635
GO:0032580	Component	Golgi cisterna membrane	IEA
GO:0032585	Component	Multivesicular body membrane	IEA
GO:0032588	Component	Trans-Golgi network membrane	ISS
GO:0036477	Component	Somatodendritic compartment	ISS
GO:0042982	Process	Amyloid precursor protein metabolic process	ISS
GO:0043202	Component	Lysosomal lumen	IEA
GO:0045211	Component	Postsynaptic membrane	IEA
GO:0048268	Process	Clathrin coat assembly	IBA	21873635
GO:0055038	Component	Recycling endosome membrane	ISS
GO:0098814	Process	Spontaneous synaptic transmission	ISS
GO:0098845	Component	Postsynaptic endosome	IEA
GO:0098887	Process	Neurotransmitter receptor transport, endosome to postsynaptic membrane	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0099003	Process	Vesicle-mediated transport in synapse	IEA
GO:0099627	Process	Neurotransmitter receptor cycle	ISS
GO:0099630	Process	Postsynaptic neurotransmitter receptor cycle	ISS
GO:1900271	Process	Regulation of long-term synaptic potentiation	ISS

MIM	HGNC	e!Ensembl
607645	18790	ENSG00000168824

Protein

UniProt ID

P42857

Protein name

Neuronal vesicle trafficking-associated protein 1 (Neuron-enriched endosomal protein of 21 kDa) (Neuron-specific protein family member 1)

Protein function

Plays a role in the recycling mechanism in neurons of multiple receptors, including AMPAR, APP and L1CAM and acts at the level of early endosomes to promote sorting of receptors toward a recycling pathway. Regulates sorting and recycling of GRIA

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF06387	Calcyon	1 → 180	D1 dopamine receptor-interacting protein (calcyon)	Family

Sequence

MVKLGNNFAEKGTKQPLLEDGFDTIPLMTPLDVNQLQFPPPDKVVVKTKTEYEPDRKKGK
ARPPQIAEFTVSITEGVTERFKVSVLVLFALAFLTCVVFLVVYKVYKYDRACPDGFVLKN
TQCIPEGLESYYAEQDSSAREKFYTVINHYNLAKQSITRSVSPWMSVLSEEKLSEQETEA
AEKSA

Sequence length

185

Interactions

View interactions

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Diabetes mellitus	Diabetes Mellitus, Non-Insulin-Dependent	rs587776515, rs61730328, rs606231121, rs606231122, rs79020217, rs77625743, rs78378398, rs606231123, rs1362648752, rs104893649, rs80356624, rs80356616, rs80356625, rs80356611, rs104894237 View all (293 more)	29221444

Show/Hide Text Mining Associations (5)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma of Lung	Associate	31731374
Esophageal Squamous Cell Carcinoma	Associate	34119530
Heart Failure	Associate	35942730
Nervous System Diseases	Associate	36493904
Severe Acute Respiratory Syndrome	Associate	32778874

NSG1 (neuronal vesicle trafficking associated 1)