Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein
Entrez ID	27065
Gene name	Neuronal vesicle trafficking associated 1
Gene symbol	NSG1
Synonyms (NCBI Gene)	D4S234D4S234ENEEP21P21
Chromosome	4
Chromosome location	4p16.3

Show/Hide all (21)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016351	hsa-miR-193b-3p	Microarray	20304954
MIRT721176	hsa-miR-3918	HITS-CLIP	19536157
MIRT721174	hsa-miR-4685-5p	HITS-CLIP	19536157
MIRT721175	hsa-miR-6837-5p	HITS-CLIP	19536157
MIRT721173	hsa-miR-1915-3p	HITS-CLIP	19536157
MIRT721171	hsa-miR-6764-5p	HITS-CLIP	19536157
MIRT721172	hsa-miR-340-3p	HITS-CLIP	19536157
MIRT721170	hsa-miR-6827-3p	HITS-CLIP	19536157
MIRT721168	hsa-miR-6515-3p	HITS-CLIP	19536157
MIRT721169	hsa-miR-1236-3p	HITS-CLIP	19536157
MIRT721167	hsa-miR-7977	HITS-CLIP	19536157
MIRT721176	hsa-miR-3918	HITS-CLIP	19536157
MIRT721174	hsa-miR-4685-5p	HITS-CLIP	19536157
MIRT721175	hsa-miR-6837-5p	HITS-CLIP	19536157
MIRT721173	hsa-miR-1915-3p	HITS-CLIP	19536157
MIRT721171	hsa-miR-6764-5p	HITS-CLIP	19536157
MIRT721172	hsa-miR-340-3p	HITS-CLIP	19536157
MIRT721170	hsa-miR-6827-3p	HITS-CLIP	19536157
MIRT721168	hsa-miR-6515-3p	HITS-CLIP	19536157
MIRT721169	hsa-miR-1236-3p	HITS-CLIP	19536157
MIRT721167	hsa-miR-7977	HITS-CLIP	19536157

Show/Hide all (62)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001881	Process	Receptor recycling	IEA
GO:0001881	Process	Receptor recycling	ISS
GO:0001921	Process	Positive regulation of receptor recycling	IEA
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005515	Function	Protein binding	IPI	25416956, 30312582, 32296183, 37207277
GO:0005634	Component	Nucleus	TAS	9013775
GO:0005737	Component	Cytoplasm	TAS	9013775
GO:0005764	Component	Lysosome	IEA
GO:0005768	Component	Endosome	IBA
GO:0005768	Component	Endosome	IEA
GO:0005768	Component	Endosome	ISS
GO:0005769	Component	Early endosome	IEA
GO:0005770	Component	Late endosome	IEA
GO:0005770	Component	Late endosome	ISS
GO:0005783	Component	Endoplasmic reticulum	IDA	20599942
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005794	Component	Golgi apparatus	IEA
GO:0006915	Process	Apoptotic process	IMP	20599942
GO:0010008	Component	Endosome membrane	IEA
GO:0016020	Component	Membrane	IBA
GO:0016020	Component	Membrane	IEA
GO:0016197	Process	Endosomal transport	IBA
GO:0016197	Process	Endosomal transport	IEA
GO:0016328	Component	Lateral plasma membrane	IEA
GO:0030425	Component	Dendrite	IEA
GO:0030425	Component	Dendrite	ISS
GO:0030659	Component	Cytoplasmic vesicle membrane	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031901	Component	Early endosome membrane	IEA
GO:0031901	Component	Early endosome membrane	ISS
GO:0031902	Component	Late endosome membrane	IEA
GO:0032051	Function	Clathrin light chain binding	IBA
GO:0032051	Function	Clathrin light chain binding	IEA
GO:0032580	Component	Golgi cisterna membrane	IEA
GO:0032585	Component	Multivesicular body membrane	IEA
GO:0032588	Component	Trans-Golgi network membrane	IEA
GO:0032588	Component	Trans-Golgi network membrane	ISS
GO:0035255	Function	Ionotropic glutamate receptor binding	IEA
GO:0036477	Component	Somatodendritic compartment	IEA
GO:0036477	Component	Somatodendritic compartment	ISS
GO:0042982	Process	Amyloid precursor protein metabolic process	IEA
GO:0042982	Process	Amyloid precursor protein metabolic process	ISS
GO:0042995	Component	Cell projection	IEA
GO:0043202	Component	Lysosomal lumen	IEA
GO:0045211	Component	Postsynaptic membrane	IEA
GO:0048268	Process	Clathrin coat assembly	IBA
GO:0048268	Process	Clathrin coat assembly	IEA
GO:0055038	Component	Recycling endosome membrane	IEA
GO:0055038	Component	Recycling endosome membrane	ISS
GO:0098814	Process	Spontaneous synaptic transmission	IEA
GO:0098814	Process	Spontaneous synaptic transmission	ISS
GO:0098845	Component	Postsynaptic endosome	IEA
GO:0098887	Process	Neurotransmitter receptor transport, endosome to postsynaptic membrane	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0099003	Process	Vesicle-mediated transport in synapse	IEA
GO:0099627	Process	Neurotransmitter receptor cycle	IEA
GO:0099627	Process	Neurotransmitter receptor cycle	ISS
GO:0099630	Process	Postsynaptic neurotransmitter receptor cycle	IEA
GO:0099630	Process	Postsynaptic neurotransmitter receptor cycle	ISS
GO:1900271	Process	Regulation of long-term synaptic potentiation	IEA
GO:1900271	Process	Regulation of long-term synaptic potentiation	ISS

MIM	HGNC	e!Ensembl
607645	18790	ENSG00000168824

P42857

Protein name

Neuronal vesicle trafficking-associated protein 1 (Neuron-enriched endosomal protein of 21 kDa) (Neuron-specific protein family member 1)

Protein function

Plays a role in the recycling mechanism in neurons of multiple receptors, including AMPAR, APP and L1CAM and acts at the level of early endosomes to promote sorting of receptors toward a recycling pathway. Regulates sorting and recycling of GRIA

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF06387	Calcyon	1 → 180	D1 dopamine receptor-interacting protein (calcyon)	Family

Sequence

MVKLGNNFAEKGTKQPLLEDGFDTIPLMTPLDVNQLQFPPPDKVVVKTKTEYEPDRKKGK
ARPPQIAEFTVSITEGVTERFKVSVLVLFALAFLTCVVFLVVYKVYKYDRACPDGFVLKN
TQCIPEGLESYYAEQDSSAREKFYTVINHYNLAKQSITRSVSPWMSVLSEEKLSEQETEA
AEKSA

Sequence length

185

Interactions

View interactions

NSG1 (neuronal vesicle trafficking associated 1)