SIGLEC7 (sialic acid binding Ig like lectin 7)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID 27036
Gene name Sialic acid binding Ig like lectin 7
Gene symbol SIGLEC7
Synonyms (NCBI Gene)
AIRM-1AIRM1CD328CDw328D-siglecQA79SIGLEC-7SIGLEC19PSIGLECP2p75p75/AIRM1
Chromosome 19
Chromosome location 19q13.41
miRNA miRNA information provided by mirtarbase database.
6
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (6)
miRTarBase ID miRNA Experiments Reference
MIRT1348567 hsa-miR-4269 CLIP-seq
MIRT1348568 hsa-miR-4514 CLIP-seq
MIRT1348569 hsa-miR-4692 CLIP-seq
MIRT1348570 hsa-miR-4742-5p CLIP-seq
MIRT1348571 hsa-miR-586 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
10
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (10)
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183
GO:0005886 Component Plasma membrane IBA
GO:0005886 Component Plasma membrane TAS 10567377
GO:0007155 Process Cell adhesion IBA
GO:0007155 Process Cell adhesion IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
604410 10876 ENSG00000168995
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9Y286
Protein name Sialic acid-binding Ig-like lectin 7 (Siglec-7) (Adhesion inhibitory receptor molecule 1) (AIRM-1) (CDw328) (D-siglec) (QA79 membrane protein) (p75) (CD antigen CD328)
Protein function Putative adhesion molecule that mediates sialic-acid dependent binding to cells. Preferentially binds to alpha-2,3- and alpha-2,6-linked sialic acid. Also binds disialogangliosides (disialogalactosyl globoside, disialyl lactotetraosylceramide an
PDB 1NKO , 1O7S , 1O7V , 2DF3 , 2G5R , 2HRL
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07686 V-set 29 → 145 Immunoglobulin V-set domain Domain
PF13895 Ig_2 257 → 338 Immunoglobulin domain Domain
Tissue specificity TISSUE SPECIFICITY: Predominantly expressed by resting and activated natural killer cells and at lower levels by granulocytes and monocytes. High expression found in placenta, liver, lung, spleen, and peripheral blood leukocytes.
Sequence 
MLLLLLLPLLWGRERVEGQKSNRKDYSLTMQSSVTVQEGMCVHVRCSFSYPVDSQTDSDP
VHGYWFRAGNDISWKAPVATNNPAWAVQEETRDRFHLLGDPQTKNCTLSIRDARMSDAGR
YFFRMEKGNIKWNYKYDQLSVNVTALTHRPNILIPGTLESGCFQNLTCSVPWACEQGTPP
MISWMGTSVSPLHPSTTRSSVLTLIPQPQHHGTSLTCQVTLPGAGVTTNRTIQLNVSYPP
QNLTVTVFQGEGTASTALGNSSSLSVLEGQSLRLVCAVDSNPPARLSWTWRSLTLYPSQP
SNPLVLELQVHLGDEGEFTCRAQNSLGSQHVSLNLSLQQEYTGKMRPVSGVLLGAVGGAG
ATALVFLSFCVIFIVVRSCRKKSARPAADVGDIGMKDANTIRGSASQGNLTESWADDNPR
HHGLAAHSSGEEREIQYAPLSFHKGEPQDLSGQEATNNEYSEIKIPK
Sequence length 467
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  Reactome
    Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Show/Hide Unknown Diseases (1)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Sarcoma Uncertain significance ClinVar
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Show/Hide Text Mining Associations (35)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References Evidence Score
Amyotrophic Lateral Sclerosis Associate 36359827
★★★★★
★☆☆☆☆
Found in Text Mining only
Breast Neoplasms Associate 33053017
★★★★★
★☆☆☆☆
Found in Text Mining only
Breast Neoplasms Stimulate 40547037
★★★★★
★☆☆☆☆
Found in Text Mining only
Carcinoma Hepatocellular Inhibit 32319079
★★★★★
★☆☆☆☆
Found in Text Mining only
Carcinoma Squamous Cell Associate 35799269
★★★★★
★☆☆☆☆
Found in Text Mining only
Cardiomyopathy Dilated Associate 27974462
★★★★★
★☆☆☆☆
Found in Text Mining only
Colorectal Neoplasms Associate 34659241
★★★★★
★☆☆☆☆
Found in Text Mining only
COVID 19 Associate 33060840
★★★★★
★☆☆☆☆
Found in Text Mining only
Drug Related Side Effects and Adverse Reactions Inhibit 29617289
★★★★★
★☆☆☆☆
Found in Text Mining only
Glioma Associate 30953118, 39211050
★★★★★
★☆☆☆☆
Found in Text Mining only