Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	2696
Gene name Gene Name - the full gene name approved by the HGNC.	Gastric inhibitory polypeptide receptor
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	GIPR
Synonyms (NCBI Gene) Gene synonyms aliases	PGQTL2
Chromosome Chromosome number	19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	19q13.32
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a G-protein coupled receptor for gastric inhibitory polypeptide (GIP), which was originally identified as an activity in gut extracts that inhibited gastric acid secretion and gastrin release, but subsequently was demonstrated to stimula

Show/Hide all(7)

miRTarBase ID	miRNA	Experiments
MIRT1019441	hsa-miR-1262	CLIP-seq
MIRT1019442	hsa-miR-2355-5p	CLIP-seq
MIRT1019443	hsa-miR-3678-5p	CLIP-seq
MIRT1019444	hsa-miR-3679-3p	CLIP-seq
MIRT1019445	hsa-miR-4701-3p	CLIP-seq
MIRT1019446	hsa-miR-4749-3p	CLIP-seq
MIRT1019447	hsa-miR-942	CLIP-seq

Transcription factors

Show/Hide all(2)

Transcription factor	Regulation	Reference
SP1	Unknown	16087722
SP3	Unknown	16087722

Show/Hide all(40)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002029	Process	Desensitization of G protein-coupled receptor signaling pathway	IEA
GO:0004888	Function	Transmembrane signaling receptor activity	IEA
GO:0004888	Function	Transmembrane signaling receptor activity	TAS	7556958
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0005515	Function	Protein binding	IPI	17715056
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	7556958
GO:0006091	Process	Generation of precursor metabolites and energy	TAS	7556958
GO:0007165	Process	Signal transduction	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	TAS	7556958
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007188	Process	Adenylate cyclase-modulating G protein-coupled receptor signaling pathway	IBA
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IDA	26572091
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IEA
GO:0007190	Process	Activation of adenylate cyclase activity	TAS	7589426
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IEA
GO:0007584	Process	Response to nutrient	TAS	7556958
GO:0008528	Function	G protein-coupled peptide receptor activity	IBA
GO:0009749	Process	Response to glucose	IEA
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	7556958
GO:0016519	Function	Gastric inhibitory peptide receptor activity	IBA
GO:0016519	Function	Gastric inhibitory peptide receptor activity	IDA	26572091
GO:0016519	Function	Gastric inhibitory peptide receptor activity	IEA
GO:0017046	Function	Peptide hormone binding	IBA
GO:0017046	Function	Peptide hormone binding	IEA
GO:0017046	Function	Peptide hormone binding	IPI	17715056, 26572091
GO:0031018	Process	Endocrine pancreas development	IEA
GO:0032024	Process	Positive regulation of insulin secretion	IEA
GO:0038192	Process	Gastric inhibitory peptide signaling pathway	IDA	26572091
GO:0038192	Process	Gastric inhibitory peptide signaling pathway	IEA
GO:0048678	Process	Response to axon injury	IEA
GO:0050796	Process	Regulation of insulin secretion	IEA
GO:0050796	Process	Regulation of insulin secretion	TAS	20081857
GO:0051592	Process	Response to calcium ion	IEA
GO:0070542	Process	Response to fatty acid	IEA
GO:0120022	Function	Glucagon family peptide binding	IPI	17715056

MIM	HGNC	e!Ensembl
137241	4271	ENSG00000010310

Protein

UniProt ID

P48546

Protein name

Gastric inhibitory polypeptide receptor (GIP-R) (Glucose-dependent insulinotropic polypeptide receptor)

Protein function

This is a receptor for GIP. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.

PDB

2QKH , 4HJ0 , 6DKJ , 7DTY , 7FIN , 7FIY , 7RA3 , 7RBT , 7VAB , 8ITL , 8ITM , 8WA3 , 8YW4

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02793	HRM	58 → 121	Hormone receptor domain	Family
PF00002	7tm_2	134 → 388	7 transmembrane receptor (Secretin family)	Family

Sequence

MTTSPILQLLLRLSLCGLLLQRAETGSKGQTAGELYQRWERYRRECQETLAAAEPPSGLA
CNGSFDMYVCWDYAAPNATARASCPWYLPWHHHVAAGFVLRQCGSDGQWGLWRDHTQCEN
PEKNEAFLDQRLILERLQVMYTVGYSLSLATLLLALLILSLFRRLHCTRNYIHINLFTSF
MLRAAAILSRDRLLPRPGPYLGDQALALWNQALAACRTAQIVTQYCVGANYTWLLVEGVY
LHSLLVLVGGSEEGHFRYYLLLGWGAPALFVIPWVIVRYLYENTQCWERNEVKAIWWIIR
TPILMTILINFLIFIRILGILLSKLRTRQMRCRDYRLRLARSTLTLVPLLGVHEVVFAPV
TEEQARGALRFAKLGFEIFLSSFQGFLVSVLYCFINKEVQSEIRRGWHHCRLRRSLGEEQ
RQLPERAFRALPSGSGPGEVPTSRGLSSGTLPGPGNEASRELESYC

Sequence length

466

Interactions

View interactions

	KEGG		Reactome
	cAMP signaling pathway Neuroactive ligand-receptor interaction Hormone signaling		G alpha (s) signalling events Glucagon-type ligand receptors ADORA2B mediated anti-inflammatory cytokines production

Show/Hide Unknown Diseases (7)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Breast Cancer	Breast cancer	N/A	N/A	GWAS
Cervical Cancer	Cervical cancer	N/A	N/A	GWAS
Diabetes	Type 2 diabetes (adjusted for BMI) or polycystic ovary syndrome (pleiotropy), Type 2 diabetes (PheCode 250.2), Type 2 diabetes or schizophrenia (pleiotropy), Type 2 diabetes, Type 2 diabetes (adjusted for BMI)	N/A	N/A	GWAS
Heart Failure	Heart failure	N/A	N/A	GWAS
Metabolic Syndrome	Metabolic syndrome	N/A	N/A	GWAS
Myocardial Infarction	Myocardial infarction	N/A	N/A	GWAS
Obesity	Obesity	N/A	N/A	GWAS

Show/Hide Text Mining Associations (39)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Acromegaly	Associate	36497102
Acth Independent Macronodular Adrenal Hyperplasia	Associate	28931750
ACTH Syndrome Ectopic	Associate	32267363
Adenoma	Associate	28931750, 34334589
Adrenal Cortex Neoplasms	Associate	28931750
Adrenal Gland Diseases	Associate	28931750
Adrenal Gland Neoplasms	Associate	34906447
Adrenocortical Adenoma	Associate	28931750, 37062723
Adrenocortical Carcinoma	Associate	25334044
Bone Diseases	Associate	33852173
Cardiovascular Diseases	Associate	34426508
Cognitive Dysfunction	Associate	36882778
Coronary Artery Disease	Associate	34426508
Cushing Syndrome	Associate	25334044, 28931750, 37062723
Diabetes Mellitus	Associate	30910378
Diabetes Mellitus Type 2	Associate	20081857, 21103350, 21810601, 22237064, 24086540, 31123324, 31330984, 34426508, 34446852, 34505161, 36140702, 36774542, 36882778, 38091482
Embolism Fat	Associate	25324507
Growth Hormone Secreting Pituitary Adenoma	Associate	37298217
Hemochromatosis	Associate	37298217
Hyperglycemia	Associate	20185807
Hyperinsulinism	Associate	20185807
Hyperplasia	Associate	28931750
Insulin Resistance	Associate	22237064, 24512489, 30089489
MASS syndrome	Associate	36140702
Metabolic Diseases	Associate	36140702
Metabolic Syndrome	Associate	36140702
Neointima	Associate	39769358
Neoplasms	Associate	24238043, 36497102
Neoplasms Adipose Tissue	Associate	34426508
Neuroendocrine Tumors	Associate	24238043, 24565507
Obesity	Associate	19254363, 22237064, 22513296, 24512489, 25324507, 26727462, 27421018, 29220676, 34426508, 34836030, 36774542, 38091482
Obesity Abdominal	Associate	25324507
Overnutrition	Associate	22237064
Overweight	Associate	22237064
Pancreatic Neoplasms	Associate	34446852, 37547756
Pituitary ACTH Hypersecretion	Associate	34906447
Pituitary Neoplasms	Associate	37298217
Weight Gain	Associate	36774542
Weight Loss	Associate	22237064

GIPR (gastric inhibitory polypeptide receptor)