Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	2688
Gene name	Growth hormone 1
Gene symbol	GH1
Synonyms (NCBI Gene)	GHGH-NGHB5GHNIGHD1AIGHD1BIGHD2hGH-N
Chromosome	17
Chromosome location	17q23.3
Summary	The protein encoded by this gene is a member of the somatotropin/prolactin family of hormones which play an important role in growth control. The gene, along with four other related genes, is located at the growth hormone locus on chromosome 17 where they

Show/Hide all (3)

SNP ID	Visualize variation	Clinical significance	Consequence
rs111957225	G>A	Conflicting-interpretations-of-pathogenicity	Coding sequence variant, synonymous variant
rs137853219	C>T	Pathogenic	Coding sequence variant, stop gained
rs140576665	G>A,C,T	Conflicting-interpretations-of-pathogenicity, uncertain-significance	Coding sequence variant, synonymous variant, missense variant

Show/Hide all (10)

miRTarBase ID	miRNA	Experiments
MIRT1018380	hsa-miR-3150a-3p	CLIP-seq
MIRT1018381	hsa-miR-3175	CLIP-seq
MIRT1018382	hsa-miR-4640-5p	CLIP-seq
MIRT1018383	hsa-miR-4667-5p	CLIP-seq
MIRT1018384	hsa-miR-4700-5p	CLIP-seq
MIRT1018385	hsa-miR-4726-5p	CLIP-seq
MIRT1018386	hsa-miR-4728-5p	CLIP-seq
MIRT1018387	hsa-miR-4768-3p	CLIP-seq
MIRT1018388	hsa-miR-665	CLIP-seq
MIRT1018389	hsa-miR-939	CLIP-seq

Show/Hide all (3)

Transcription factor	Regulation	Reference
HNF4A	Repression	17991764
POU1F1	Activation	16061841;7529501
POU1F1	Unknown	11081207;11874696;15998782;17456792;7608249;7877625;9207961

Show/Hide all (50)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002092	Process	Positive regulation of receptor internalization	IDA	9360546
GO:0005125	Function	Cytokine activity	IDA	7782332
GO:0005131	Function	Growth hormone receptor binding	IBA
GO:0005131	Function	Growth hormone receptor binding	IDA	6303755, 8063815
GO:0005131	Function	Growth hormone receptor binding	IEA
GO:0005131	Function	Growth hormone receptor binding	IPI	1549776, 2825030, 8943276, 9571026
GO:0005148	Function	Prolactin receptor binding	IDA	10890569
GO:0005148	Function	Prolactin receptor binding	IPI	7984244
GO:0005179	Function	Hormone activity	IBA
GO:0005179	Function	Hormone activity	IEA
GO:0005515	Function	Protein binding	IPI	8943276, 9353194, 31279174
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	5810834
GO:0005615	Component	Extracellular space	IDA	11549663
GO:0005615	Component	Extracellular space	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0007259	Process	Cell surface receptor signaling pathway via JAK-STAT	IDA	8063815
GO:0008083	Function	Growth factor activity	IBA
GO:0008083	Function	Growth factor activity	IDA	1549776
GO:0008083	Function	Growth factor activity	IPI	9360546
GO:0010828	Process	Positive regulation of D-glucose transmembrane transport	IDA	9144201
GO:0012505	Component	Endomembrane system	IEA
GO:0019221	Process	Cytokine-mediated signaling pathway	IDA	7782332
GO:0031012	Component	Extracellular matrix	HDA	28327460
GO:0031667	Process	Response to nutrient levels	IBA
GO:0031904	Component	Endosome lumen	TAS
GO:0031982	Component	Vesicle	IEA
GO:0032355	Process	Response to estradiol	IDA	12552091
GO:0040018	Process	Positive regulation of multicellular organism growth	IDA	7565946, 20110402
GO:0040018	Process	Positive regulation of multicellular organism growth	IMP	8496314
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IDA	21980433
GO:0043410	Process	Positive regulation of MAPK cascade	TAS	8063815
GO:0043568	Process	Positive regulation of insulin-like growth factor receptor signaling pathway	IDA	7565946
GO:0046427	Process	Positive regulation of receptor signaling pathway via JAK-STAT	IBA
GO:0046427	Process	Positive regulation of receptor signaling pathway via JAK-STAT	IDA	8923468
GO:0046872	Function	Metal ion binding	IEA
GO:0048513	Process	Animal organ development	IBA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	7782332
GO:0060396	Process	Growth hormone receptor signaling pathway	IBA
GO:0060396	Process	Growth hormone receptor signaling pathway	IDA	2825030
GO:0060396	Process	Growth hormone receptor signaling pathway	IDA	1549776, 8063815
GO:0060397	Process	Growth hormone receptor signaling pathway via JAK-STAT	IDA	15690087
GO:0060397	Process	Growth hormone receptor signaling pathway via JAK-STAT	IDA	12552091
GO:0060400	Process	Negative regulation of growth hormone receptor signaling pathway	IDA	21980433
GO:0070186	Function	Growth hormone activity	IDA	1549776, 8063815, 8943276
GO:0070195	Component	Growth hormone receptor complex	IDA	1549776, 8943276, 9571026
GO:0070977	Process	Bone maturation	IDA	20110402
GO:0097696	Process	Cell surface receptor signaling pathway via STAT	IDA	12552091

MIM	HGNC	e!Ensembl
139250	4261	ENSG00000259384

P01241

Protein name

Somatotropin (Growth hormone) (GH) (GH-N) (Growth hormone 1) (Pituitary growth hormone)

Protein function

Plays an important role in growth control. Its major role in stimulating body growth is to stimulate the liver and other tissues to secrete IGF1. It stimulates both the differentiation and proliferation of myoblasts. It also stimulates amino aci

PDB

1A22 , 1AXI , 1BP3 , 1HGU , 1HUW , 1HWG , 1HWH , 1KF9 , 3HHR , 6QIO

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00103	Hormone_1	9 → 215	Somatotropin hormone family	Domain

Sequence

MATGSRTSLLLAFGLLCLPWLQEGSAFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEA
YIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLR
SVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDD
ALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF

Sequence length

217

Interactions

View interactions

	KEGG		Reactome
	Cytokine-cytokine receptor interaction Neuroactive ligand-receptor interaction Hormone signaling PI3K-Akt signaling pathway JAK-STAT signaling pathway Growth hormone synthesis, secretion and action		Prolactin receptor signaling Synthesis, secretion, and deacylation of Ghrelin Growth hormone receptor signaling

139

Show/Hide Causal Diseases (6)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Ateleiotic dwarfism	Likely pathogenic; Pathogenic	rs1907478805, rs1907472729, rs137853219, rs2509253023, rs71640277	RCV005860212 RCV000017332 RCV000017333 RCV000017335 RCV002504799
Autosomal dominant isolated somatotropin deficiency	Likely pathogenic; Pathogenic	rs1567803095, rs2509250234, rs797044450, rs71640277, rs863223306, rs2144738731, rs863223307, rs2144739370, rs863223309, rs863223310, rs2509250570, rs137853223, rs2144739380, rs2144739391, rs754126557	RCV002279179 RCV003455852 RCV000017338 RCV000017340 RCV000017341 RCV000017342 RCV000017343 RCV000017345 RCV000017347 RCV000017349 RCV000017350 RCV000017352 RCV000017353 RCV000017354 RCV000017355 RCV001293731
GH1-related disorder	Likely pathogenic; Pathogenic	rs2144739391	RCV003894809
Idiopathic growth hormone deficiency	Pathogenic; Likely pathogenic	rs863223307, rs2509251319	RCV004700243 RCV003988556
Isolated growth hormone deficiency type IB	Pathogenic	rs797044449, rs71640277, rs863223308	RCV000017337 RCV002504799 RCV000017346
Short stature due to growth hormone qualitative anomaly	Pathogenic	rs137853220, rs71640277, rs137853221, rs137853222	RCV000017339 RCV002504799 RCV000017344 RCV000017351

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Decreased response to growth hormone stimulation test	Conflicting classifications of pathogenicity; Benign; Likely benign; Uncertain significance	rs61735359, rs61735357, rs370785603, rs5388, rs151263636, rs2001345, rs200503313, rs71640274, rs754207595, rs754099689, rs6175, rs759813905, rs377600944, rs61762498, rs140576665 View all (29 more)	RCV001122918 RCV001122917 RCV001128610 RCV001128609 RCV000363532 RCV001126654 RCV000312365 RCV000398141 RCV000266675 RCV000265811 RCV000318527 RCV000390799 RCV000294515 RCV000351723 RCV000324175 RCV000364589 RCV000306584 RCV000357936 RCV001126653 RCV001123896 RCV001128608 RCV001126544 RCV001123897 RCV001126543 RCV001126545 RCV001126546 RCV001126547 RCV001126548 RCV001128611 RCV001128612 RCV001128613 RCV001128614 RCV001122914 RCV001122916 RCV001123980 RCV001123981 RCV001123982 RCV001123983 RCV001123984 RCV001126655 RCV001126656 RCV001126657 RCV001122913 RCV001122915
Isolated congenital growth hormone deficiency	Uncertain significance; Benign; Likely benign	rs886053236, rs695, rs6171	RCV000398146 RCV000302385 RCV000343147 RCV000399451

Show/Hide Text Mining Associations (231)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Abnormalities Drug Induced	Associate	28768959
Abnormalities Drug Induced	Inhibit	7670563
Abortion Spontaneous	Associate	36950683
Achondroplasia	Associate	12733711, 16618986, 27147792
Acromegaly	Stimulate	11404775, 26863932, 27503591, 28002537, 29266696, 30742299, 30843342, 31771524, 33019423, 34027406, 34282806
Acromegaly	Associate	15761655, 16126556, 17242703, 18840925, 19293545, 19637311, 2118540, 23640965, 23648743, 25470569, 27070751, 27403655, 27982199, 31189769, 32079542 View all (7 more)
ACTH Secreting Pituitary Adenoma	Associate	15118275, 23648743
Adenoma	Associate	14762579, 2273209, 30684245, 33010004, 34334589, 34530798
Adenoma Islet Cell	Stimulate	6243140
Adrenal Hyperplasia Congenital	Associate	28126912
Adrenoleukodystrophy	Stimulate	25470569
Anemia Aplastic	Stimulate	14599122
Aneuploidy	Inhibit	36950683
Anterior Spinal Artery Syndrome	Associate	27503591
Aryl Hydrocarbon Hydroxylase Inducibility	Stimulate	33010004
Ataxia	Associate	26108478
Autistic Disorder	Associate	12898583
Bipolar Disorder	Inhibit	35986174
Bone Diseases	Associate	21995288
Bone Diseases Metabolic	Associate	37525886
Borjeson Forssman Lehmann syndrome	Associate	30630810
Brain Neoplasms	Associate	28746941
Breast Neoplasms	Associate	11290538, 11297545, 11994274, 15241820, 15353581, 15845533, 23782942, 26225688
Cachexia	Associate	1730091
Cancer Pain	Associate	29469136
Carcinogenesis	Associate	11404775
Carcinogenesis	Stimulate	30786680
Carcinoma Hepatocellular	Associate	28617312
Carcinoma Squamous Cell	Associate	21897749
Cardiomyopathy Hypertrophic	Associate	34757052, 34896604
Cardiovascular Diseases	Associate	39354608
Carney Complex	Associate	15761655, 27535175, 38626285
Cholangiocarcinoma	Associate	36098712
Chromosome 15 ring	Inhibit	7545237
Chromosome 8 trisomy	Associate	14599122
Chromosome Aberrations	Associate	14599122
Chronobiology Disorders	Associate	33852720
Cleidocranial Dysplasia	Inhibit	30468148
Cockayne Syndrome	Associate	26755826
Coffin Siris syndrome	Associate	35964110, 39279315
Cognition Disorders	Inhibit	27852283
Cognition Disorders	Associate	30081594
Cognitive Dysfunction	Associate	30372675
Colonic Polyps	Associate	20580999
Colorectal Neoplasms	Associate	18255351, 19064544
Combined Pituitary Hormone Deficiency	Inhibit	17162714, 28332357
Combined Pituitary Hormone Deficiency	Associate	34440302, 35029852, 35456463
Congenital Abnormalities	Inhibit	21123951
Congenital Abnormalities	Associate	33615449
COVID 19	Associate	36175845
Cranial Nerve Neoplasms	Associate	28746941
Creutzfeldt Jakob Syndrome	Associate	14695328, 20007724, 25279832, 26108478, 26840342, 40439459
Creutzfeldt Jakob Syndrome	Stimulate	26268531
Cytomegalovirus Infections	Associate	12368327
Dementia Multi Infarct	Associate	39341815
Diabetes Gestational	Associate	31689713
Diabetes Mellitus	Associate	29351335, 33795655, 36549505
Diabetes Mellitus Type 1	Associate	11725827
Dwarfism Pituitary	Inhibit	10794594, 14599122, 20158889, 24398869, 26719670, 28780521, 28872989, 29537382, 31079043, 33578586, 34412613, 36960394, 37010587, 40198521, 5480844, 8818955 View all (1 more)
Dwarfism Pituitary	Associate	10943739, 11509865, 17178704, 2325087, 25920498, 26108478, 26444854, 27651465, 28067847, 28332357, 30678423, 31835104, 32338337, 32652002, 32936763 View all (7 more)
Dwarfism Pituitary	Stimulate	37611564
Dysbiosis	Associate	31959989
Embolism Fat	Associate	29031905
Encephalitis Tick Borne	Associate	17178704
Endocrine System Diseases	Associate	10890176
Facial Dysmorphism with Multiple Malformations	Associate	25433523
Fatty Liver	Associate	30206761
Fetal Growth Retardation	Stimulate	23583218
Fetal Growth Retardation	Associate	33686842
Fibrous Dysplasia of Bone	Associate	11836449, 27535175, 34989160
Fibrous Dysplasia Polyostotic	Associate	18445999, 27535175
Floating harbor syndrome	Associate	31200758
Fractures Bone	Inhibit	12568401
Frailty	Associate	39464190
Gastritis Atrophic	Associate	15334699
Genetic Diseases Inborn	Associate	16618986, 1999489
Germinoma	Associate	19466616
Gigantism	Associate	17242703, 21208107, 25470569, 26797872
Gigantism	Stimulate	31365626, 34972788
Glomerulosclerosis Focal Segmental	Associate	31771524
Gonadal Disorders	Associate	18840925
Graft vs Host Disease	Associate	8944430
Graves Ophthalmopathy	Associate	34412613
Growth Disorders	Associate	10943739, 19189700, 20013551, 22333897, 28768959, 29469136, 29687007, 31566922, 31835104, 32132170, 32338337, 32652002, 33686842, 34740356, 35029852 View all (8 more)
Growth Disorders	Inhibit	17241478, 27125300, 29197219, 30017534, 30468148, 31883394, 34922359, 35764954, 36635911, 36734391, 40487758
Growth Hormone Secreting Pituitary Adenoma	Associate	31189769, 33281746, 35947334
Hashimoto Disease	Associate	30786680
Heart Diseases	Stimulate	34757052
Hemochromatosis	Associate	36597844
Hereditary Breast and Ovarian Cancer Syndrome	Associate	22333897
Hereditary renal agenesis	Associate	34440302
Hhhh Syndrome	Associate	25826153
HIV Infections	Associate	1730091, 33852720
Hyperandrogenism	Associate	18840925
Hyperglycemic Hyperosmolar Nonketotic Coma	Inhibit	30823632
Hyperinsulinism	Associate	15339744
Hyperinsulinism	Stimulate	19625744
Hyperplasia	Associate	26797872
Hypertension	Associate	8069405
Hyperthyroidism	Associate	37876543
Hypertrichosis Terminalis Generalized with or without Gingival Hyperplasia	Associate	33686842
Hypertrophy	Stimulate	212575
Hypochondroplasia	Associate	12733711
Hypoglycemia	Associate	31448886, 3917947
hypoglycemic encephalopathy	Associate	26496258
hypoglycemic encephalopathy	Inhibit	33113547
Hypogonadism	Associate	17588847
Hypogonadism	Inhibit	33565750
Hyponatremia	Associate	31448886
Hypophosphatemia	Associate	19773212
Hypopituitarism	Associate	1404301, 34440302
Hypothyroidism	Associate	35029852, 9675567
Hypoxia	Stimulate	32111982
Immunologic Deficiency Syndromes	Associate	19926713
Inflammation	Associate	26732162, 33852720, 36577365
Inflammation	Inhibit	36175845
Insulin Resistance	Stimulate	15339744
Insulin Resistance	Associate	18840925, 30325658, 36549505
Intestinal Fistula	Associate	19058314
Isolated Growth Hormone Deficiency Type II	Associate	17178704, 18554279, 21707947, 30678423, 34470639, 35029852, 9152628
Joint Instability	Inhibit	30556359
Kabuki syndrome	Associate	30556359, 34607328
Kidney Diseases	Stimulate	31771524
Laron Syndrome	Associate	1719554, 1999489, 2233903, 2813379, 31835104, 34136918, 36549505, 8137822
Laron Syndrome	Stimulate	31883394
Laron Syndrome	Inhibit	38597155
Leukemia	Associate	14599122
Leukemia Myelogenous Chronic BCR ABL Positive	Stimulate	2799810
Leukocytosis	Stimulate	2799810
Liver Diseases	Associate	36973824
Lung Diseases	Associate	2145655
Lymphedema	Associate	31685880
Lymphoproliferative Syndrome X Linked 2	Stimulate	26797872
Malnutrition	Inhibit	36973824
Malnutrition	Associate	37251684
Mandibular Injuries	Associate	37611564
Mental Disorders	Associate	33114160, 4250364
Mental Disorders	Inhibit	37343528
Metabolic Diseases	Associate	27070751, 39354608
Metabolic Syndrome	Stimulate	29266696
Miller McKusick Malvaux Syndrome (3M Syndrome)	Associate	28675896
Miller McKusick Malvaux Syndrome (3M Syndrome)	Inhibit	33107243
Mitral Valve Insufficiency	Associate	38141725
Myxoma	Stimulate	27535175
Nails Malformed	Associate	31685880
Neoplasm Metastasis	Associate	24077272, 30786680
Neoplasms	Associate	12721095, 17440235, 19293545, 24022308, 24077272, 24134847, 28617312, 28746941, 30742299, 30786680, 32786367, 34769292, 34896604, 35029852, 36952491, 37811868, 6243140, 8669961 View all (3 more)
Neoplasms	Stimulate	15241820, 34344408
Neuroendocrine Tumors	Associate	36435867, 38003353
Neurofibroma Plexiform	Associate	18297205
Neurofibromatosis 1	Associate	18297205
Non alcoholic Fatty Liver Disease	Associate	33125080, 33852720
Noonan Syndrome	Associate	2001114, 22524084, 22777296, 26444854, 28746941, 34757052, 34858328
Noonan Syndrome	Inhibit	27125300
Obesity	Inhibit	18567561, 22518832, 23529462
Obesity	Associate	20150954, 20580999, 23015655, 26680478, 26774404, 31698873, 35876725, 40147358
Obesity Abdominal	Associate	26774404
Obesity Maternal	Associate	29763375
Oculocerebrorenal Syndrome	Associate	19773212
Oculodigitoesophagoduodenal syndrome	Associate	30672094
Osteochondrodysplasias	Associate	34010451
Osteogenesis Imperfecta Type IV	Inhibit	12568401
Osteoporosis	Inhibit	19773212
Osteoporosis	Stimulate	32846772
Pancreatic Neoplasms	Inhibit	9420436
Pancreatitis	Stimulate	35313971
Papilledema	Associate	33006547
Paroxysmal ventricular fibrillation	Associate	30503129
Pituitary ACTH Hypersecretion	Associate	18840925, 35029852
Pituitary Diseases	Associate	21707947, 24302194, 27506760, 28002537, 30678423
Pituitary dwarfism 1	Associate	34470639, 8151648
Pituitary Hormone Deficiency Combined 1	Inhibit	40141050
Pituitary Neoplasms	Associate	11836449, 15070915, 15118275, 16622555, 17242703, 18445999, 19637311, 20507346, 21208107, 21744088, 23648743, 24077272, 26037177, 27779153, 28705113 View all (15 more)
Pituitary Neoplasms	Stimulate	15761655, 16505278, 18840925, 19293545, 27503591, 29266696, 9420436
Polycystic Kidney Autosomal Dominant	Associate	21744088
Polycystic Ovary Syndrome	Associate	18840925, 33287836
Postural Orthostatic Tachycardia Syndrome	Stimulate	32321428
Prader Willi Syndrome	Associate	18567561, 23696513, 24515997, 26842920, 27852283, 31313492, 31698873, 31782896, 33114160, 33565750, 33615449, 34344408, 36750945
Prader Willi Syndrome	Inhibit	30209801, 31689713, 35870983, 35876725
Pre Eclampsia	Associate	22387044
Pregnancy Complications Hematologic	Associate	25920498
Pregnancy Ectopic	Associate	34440302
Pregnancy in Diabetics	Associate	9675567
Prion Diseases	Associate	26108478, 26268531
Progressive hearing loss stapes fixation	Stimulate	25470569
Progressive hearing loss stapes fixation	Associate	35202564, 40684399
Prolactinoma	Associate	26797872, 32597492, 38003353
Proteinuria	Associate	33795655
Pseudohypoparathyroidism	Associate	25464124, 27425121, 34740356
Pseudotumor Cerebri	Stimulate	33006547
Puberty Precocious	Associate	24932606, 31079043
Puberty Precocious	Inhibit	32846772
Pulmonary Arterial Hypertension	Inhibit	31685880
Purpura	Inhibit	14599122
Pyruvate Dehydrogenase E3 Binding Protein Deficiency	Inhibit	29197219
Renal Insufficiency	Associate	15138811, 26902202, 29537382, 32132170, 36950683, 37251684
Renal Insufficiency	Inhibit	17162714, 2799810, 30786680, 36546418
Renal Insufficiency Chronic	Associate	25659076
Respiratory Insufficiency	Inhibit	37343528
Retrognathia	Associate	31685880
Rickets Hypophosphatemic	Inhibit	19773212
Schaaf Yang syndrome	Inhibit	37343528
Septo Optic Dysplasia	Associate	24932606
Short Bowel Syndrome	Inhibit	23390995
Short Bowel Syndrome	Associate	25080462
Short Stature Idiopathic Autosomal	Associate	16884491, 23419423, 28768959, 31353328, 31566922, 32338337, 35585611
Silver Russell Syndrome	Inhibit	28872989, 35261046, 36734391
Silver Russell Syndrome	Associate	37335065
Sleep Apnea Syndromes	Associate	18468308
Sleep Deprivation	Associate	23490203
Smith Magenis Syndrome	Associate	15138811
Spondyloenchondrodysplasia	Associate	37010587
Spondyloepiphyseal dysplasia congenita	Associate	39953747
Stomach Neoplasms	Associate	11404775, 15069712
Sweet Syndrome	Associate	39354608
Thyroid Cancer Papillary	Associate	30786680
Thyroid Hormone Resistance Syndrome	Associate	25464124
Tourette Syndrome	Inhibit	32462855
Tuberculosis Meningeal	Stimulate	32265833
Turner Syndrome	Associate	12905513, 2168659, 23539612, 25826153, 27651465, 29699389, 31685880, 34858328
Turner Syndrome	Inhibit	20733274, 30786680, 36734391, 37476877
Uniparental Disomy	Associate	31079043
Uniparental Disomy	Inhibit	31313492
Voice Disorders	Associate	35315986
Weight Gain	Associate	20580999
Weight Gain	Inhibit	22948460
Weight Gain	Stimulate	33107243
Weight Loss	Stimulate	26108478
Weight Loss	Associate	39354608
Williams Syndrome	Inhibit	35876725
X Linked Combined Immunodeficiency Diseases	Associate	12197892, 19189700

GH1 (growth hormone 1)