Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	266743
Gene name Gene Name - the full gene name approved by the HGNC.	Neuronal PAS domain protein 4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	NPAS4
Synonyms (NCBI Gene) Gene synonyms aliases	Le-PAS, NXF, PASD10, bHLHe79
Chromosome Chromosome number	11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	11q13.2
Summary Summary of gene provided in NCBI Entrez Gene.	NXF is a member of the basic helix-loop-helix-PER (MIM 602260)-ARNT (MIM 126110)-SIM (see SIM2; MIM 600892) (bHLH-PAS) class of transcriptional regulators, which are involved in a wide range of physiologic and developmental events (Ooe et al., 2004 [PubMe

Show/Hide all(5)

miRTarBase ID	miRNA	Experiments
MIRT2391679	hsa-miR-1224-3p	CLIP-seq
MIRT2391680	hsa-miR-1260	CLIP-seq
MIRT2391681	hsa-miR-1260b	CLIP-seq
MIRT2391682	hsa-miR-1280	CLIP-seq
MIRT2391683	hsa-miR-532-3p	CLIP-seq

Show/Hide all(26)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IBA	21873635
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	14701734
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IDA	24465693
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	14701734
GO:0005515	Function	Protein binding	IPI	24465693
GO:0005634	Component	Nucleus	IEA
GO:0005667	Component	Transcription regulator complex	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA	21873635
GO:0007612	Process	Learning	ISS
GO:0007614	Process	Short-term memory	ISS
GO:0007616	Process	Long-term memory	ISS
GO:0030154	Process	Cell differentiation	IEA
GO:0032228	Process	Regulation of synaptic transmission, GABAergic	ISS
GO:0035176	Process	Social behavior	ISS
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	14701734, 24465693
GO:0046982	Function	Protein heterodimerization activity	IDA	24465693
GO:0048167	Process	Regulation of synaptic plasticity	ISS
GO:0060079	Process	Excitatory postsynaptic potential	ISS
GO:0060080	Process	Inhibitory postsynaptic potential	ISS
GO:0071386	Process	Cellular response to corticosterone stimulus	IEA
GO:0098794	Component	Postsynapse	IEA
GO:1904862	Process	Inhibitory synapse assembly	ISS

MIM	HGNC	e!Ensembl
608554	18983	ENSG00000174576

Protein

UniProt ID

Q8IUM7

Protein name

Neuronal PAS domain-containing protein 4 (Neuronal PAS4) (Class E basic helix-loop-helix protein 79) (bHLHe79) (HLH-PAS transcription factor NXF) (PAS domain-containing protein 10)

Protein function

Transcription factor expressed in neurons of the brain that regulates the excitatory-inhibitory balance within neural circuits and is required for contextual memory in the hippocampus (By similarity). Plays a key role in the structural and funct

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF08447	PAS_3	227 → 300	PAS fold	Domain

Tissue specificity

TISSUE SPECIFICITY: Brain. {ECO:0000269|PubMed:14701734}.

Sequence

MYRSTKGASKARRDQINAEIRNLKELLPLAEADKVRLSYLHIMSLACIYTRKGVFFAGGT
PLAGPTGLLSAQELEDIVAALPGFLLVFTAEGKLLYLSESVSEHLGHSMVDLVAQGDSIY
DIIDPADHLTVRQQLTLPSALDTDRLFRCRFNTSKSLRRQSAGNKLVLIRGRFHAHPPGA
YWAGNPVFTAFCAPLEPRPRPGPGPGPGPASLFLAMFQSRHAKDLALLDISESVLIYLGF
ERSELLCKSWYGLLHPEDLAHASAQHYRLLAESGDIQAEMVVRLQAKTGGWAWIYCLLYS
EGPEGPITANNYPISDMEAWSLRQQLNSEDTQAAYVLGTPTMLPSFPENILSQEECSSTN
PLFTAALGAPRSTSFPSAPELSVVSASEELPRPSKELDFSYLTFPSGPEPSLQAELSKDL
VCTPPYTPHQPGGCAFLFSLHEPFQTHLPTPSSTLQEQLTPSTATFSDQLTPSSATFPDP
LTSPLQGQLTETSVRSYEDQLTPCTSTFPDQLLPSTATFPEPLGSPAHEQLTPPSTAFQA
HLDSPSQTFPEQLSPNPTKTYFAQEGCSFLYEKLPPSPSSPGNGDCTLLALAQLRGPLSV
DVPLVPEGLLTPEASPVKQSFFHYSEKEQNEIDRLIQQISQLAQGMDRPFSAEAGTGGLE
PLGGLEPLDSNLSLSGAGPPVLSLDLKPWKCQELDFLADPDNMFLEETPVEDIFMDLSTP
DPSEEWGSGDPEAEGPGGAPSPCNNLSPEDHSFLEDLATYETAFETGVSAFPYDGFTDEL
HQLQSQVQDSFHEDGSGGEPTF

Sequence length

802

Interactions

View interactions

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Schizophrenia	Schizophrenia	rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346 View all (12 more)	23029555

Show/Hide Unknown Diseases (2)

Disease term	Disease name	Source
Unknown
Neurodevelopmental Disorders	complex neurodevelopmental disorder	GenCC
Insomnia	Insomnia	GWAS

Show/Hide Text Mining Associations (9)

Disease Name	Relationship Type	References
Associations from Text Mining
Developmental Disabilities	Associate	33758288
Disease	Associate	31619230
Growth Disorders	Associate	22030050
Inflammation	Associate	37938766
Intellectual Disability	Associate	22030050
Laryngeal Neoplasms	Associate	36033826
Metabolic Diseases	Associate	36343253
Primary Ovarian Insufficiency	Associate	22030050
Schizophrenia	Associate	33758288

NPAS4 (neuronal PAS domain protein 4)