Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
266722
Gene name Gene Name - the full gene name approved by the HGNC.
Heparan sulfate 6-O-sulfotransferase 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
HS6ST3
Synonyms (NCBI Gene) Gene synonyms aliases
HS6ST-3
Chromosome Chromosome number
13
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
13q32.1
Summary Summary of gene provided in NCBI Entrez Gene.
Heparan sulfate (HS) sulfotransferases, such as HS6ST3, modify HS to generate structures required for interactions between HS and a variety of proteins. These interactions are implicated in proliferation and differentiation, adhesion, migration, inflammat
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT018336 hsa-miR-335-5p Microarray 18185580
MIRT607779 hsa-miR-4688 HITS-CLIP 19536157
MIRT607778 hsa-miR-6743-5p HITS-CLIP 19536157
MIRT607775 hsa-miR-486-3p HITS-CLIP 19536157
MIRT607774 hsa-miR-597-5p HITS-CLIP 19536157
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005794 Component Golgi apparatus IEA
GO:0005794 Component Golgi apparatus IEA
GO:0008146 Function Sulfotransferase activity IEA
GO:0015012 Process Heparan sulfate proteoglycan biosynthetic process IBA
GO:0015012 Process Heparan sulfate proteoglycan biosynthetic process IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
609401 19134 ENSG00000185352
Protein
UniProt ID Q8IZP7
Protein name Heparan-sulfate 6-O-sulfotransferase 3 (HS6ST-3) (EC 2.8.2.-)
Protein function 6-O-sulfation enzyme which catalyzes the transfer of sulfate from 3'-phosphoadenosine 5'-phosphosulfate (PAPS) to position 6 of the N-sulfoglucosamine residue (GlcNS) of heparan sulfate.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF03567 Sulfotransfer_2 138 411 Sulfotransferase family Domain
Sequence
MDERFNKWLLTPVLTLLFVVIMYQYVSPSCTSSCTNFGEQPRAGEAGPPAVPGPARRAQA
PPEEWERRPQLPPPPRGPPEGPRGAAAPEEEDEEPGDPREGEEEEEEDEPDPEAPENGSL
PRFVPRFNFSLKDLTRFVDFNIKGRDVIVFLHIQKTGGTTFGRHLVKNIRLEQPCSCKAG
QKKCTCHRPGKKETWLFSRFSTGWSCGLHADWTELTNCVPAIMEKKDCPRNHSHTRNFYY
ITMLRDPVSRYLSEWKHVQRGATWKTSLHMCDGRSPTPDELPTCYPGDDWSGVSLREFMD
CTYNLANNRQVRMLADLSLVGCYNLTFMNESERNTILLQSAKNNLKNMAFFGLTEFQRKT
QFLFERTFNLKFISPFTQFNITRASNVEINEGARQRIEDLNFLDMQLYEYA
KDLFQQRYH
HTKQLEHQRDRQKRREERRLQREHRDHQWPKEDGAAEGTVTEDYNSQVVRW
Sequence length 471
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Glycosaminoglycan biosynthesis - heparan sulfate / heparin   HS-GAG biosynthesis
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Diabetes Type 2 diabetes N/A N/A GWAS
Diabetic Retinopathy Diabetic retinopathy N/A N/A GWAS
Glioblastoma Glioblastoma N/A N/A GWAS
Gout Gout N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Diabetes Mellitus Type 2 Associate 27863428
Obesity Associate 23563607