OFCC1 (orofacial cleft 1 candidate 1 (pseudogene))

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein
Entrez ID 266553
Gene name Orofacial cleft 1 candidate 1 (pseudogene)
Gene symbol OFCC1
Synonyms (NCBI Gene)
MRDS1Opo
Chromosome 6
Chromosome location 6p24.3
miRNA miRNA information provided by mirtarbase database.
1
Gene miRNA Gene ontology Other IDs Protein
Show/Hide all (1)
miRTarBase ID miRNA Experiments Reference
MIRT025134 hsa-miR-181a-5p Microarray 17612493
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
1
Gene miRNA Gene ontology Other IDs Protein
Show/Hide all (1)
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 23455924, 32814053
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein
MIM HGNC e!Ensembl
614287 21017 HGNC
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8IZS5
Protein name Orofacial cleft 1 candidate gene 1 protein (Orofacial clefting chromosomal breakpoint region candidate 1 protein)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF15680 OFCC1 5 → 113 Family
Sequence 
MEREKFQQKALKQTKQKKSKSAEFLMVKEDREATEGTGNPAFNMSSPDLSACQTAEKKVI
RHDMPDRTLAAHQQKFRLPASAEPKGNEYGRNYFDPLMDEEINPRQCATEVSREDDDRIF
YNRLTKLFDESRQGEPQDESGREETLNSEAPGSSNKSHEIHKEASEATTAHLEEFQRSQK
TIILLGSSPLEQEIRSTSLHCMEDEMSHPWILLLKVTAVIRSRRYYREQRF
Sequence length 231
Interactions View interactions