Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	2662
Gene name Gene Name - the full gene name approved by the HGNC.	Growth differentiation factor 10
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	GDF10
Synonyms (NCBI Gene) Gene synonyms aliases	BIP, BMP-3b, BMP3B
Chromosome Chromosome number	10
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	10q11.22
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate

Show/Hide all(29)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019185	hsa-miR-335-5p	Microarray	18185580
MIRT023151	hsa-miR-124-3p	Microarray	18668037
MIRT030335	hsa-miR-26b-5p	Microarray	19088304
MIRT1015617	hsa-miR-299-3p	CLIP-seq
MIRT1015618	hsa-miR-3136-3p	CLIP-seq
MIRT1015619	hsa-miR-3163	CLIP-seq
MIRT1015620	hsa-miR-3545-3p	CLIP-seq
MIRT1015621	hsa-miR-4255	CLIP-seq
MIRT1015622	hsa-miR-4491	CLIP-seq
MIRT1015623	hsa-miR-4539	CLIP-seq
MIRT1015624	hsa-miR-4657	CLIP-seq
MIRT1015625	hsa-miR-4668-3p	CLIP-seq
MIRT1015626	hsa-miR-520d-5p	CLIP-seq
MIRT1015627	hsa-miR-520g	CLIP-seq
MIRT1015628	hsa-miR-520h	CLIP-seq
MIRT1015629	hsa-miR-524-5p	CLIP-seq
MIRT1015630	hsa-miR-663b	CLIP-seq
MIRT2234164	hsa-miR-1184	CLIP-seq
MIRT2234165	hsa-miR-1205	CLIP-seq
MIRT2234166	hsa-miR-1301	CLIP-seq
MIRT2234167	hsa-miR-3130-3p	CLIP-seq
MIRT2234168	hsa-miR-3158-5p	CLIP-seq
MIRT2234169	hsa-miR-346	CLIP-seq
MIRT2234170	hsa-miR-4288	CLIP-seq
MIRT2234171	hsa-miR-4660	CLIP-seq
MIRT2234172	hsa-miR-4711-3p	CLIP-seq
MIRT2234173	hsa-miR-5047	CLIP-seq
MIRT2234174	hsa-miR-632	CLIP-seq
MIRT2234175	hsa-miR-767-5p	CLIP-seq

Show/Hide all(27)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001501	Process	Skeletal system development	IEA
GO:0001501	Process	Skeletal system development	TAS	8670277
GO:0001503	Process	Ossification	IEA
GO:0001649	Process	Osteoblast differentiation	IEA
GO:0005125	Function	Cytokine activity	IBA
GO:0005125	Function	Cytokine activity	IC	22155034
GO:0005125	Function	Cytokine activity	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0007178	Process	Cell surface receptor protein serine/threonine kinase signaling pathway	IBA
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	TAS	8679252
GO:0008083	Function	Growth factor activity	IEA
GO:0008083	Function	Growth factor activity	TAS	8679252
GO:0021549	Process	Cerebellum development	IEA
GO:0030278	Process	Regulation of ossification	IEA
GO:0030279	Process	Negative regulation of ossification	IDA	22155034
GO:0030279	Process	Negative regulation of ossification	IDA	22155034
GO:0030279	Process	Negative regulation of ossification	IEA
GO:0031012	Component	Extracellular matrix	HDA	27068509
GO:0042698	Process	Ovulation cycle	IEA
GO:0043539	Function	Protein serine/threonine kinase activator activity	IC	22155034
GO:0045444	Process	Fat cell differentiation	IEA
GO:0045669	Process	Positive regulation of osteoblast differentiation	IBA
GO:0045669	Process	Positive regulation of osteoblast differentiation	IEA
GO:0071559	Process	Response to transforming growth factor beta	IEA
GO:1904373	Process	Response to kainic acid	IEA

MIM	HGNC	e!Ensembl
601361	4215	ENSG00000266524

Protein

UniProt ID

P55107

Protein name

Growth/differentiation factor 10 (GDF-10) (Bone morphogenetic protein 3B) (BMP-3B) (Bone-inducing protein) (BIP)

Protein function

Growth factor involved in osteogenesis and adipogenesis. Plays an inhibitory role in the process of osteoblast differentiation via SMAD2/3 pathway. Plays an inhibitory role in the process of adipogenesis.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00019	TGF_beta	375 → 477	Transforming growth factor beta like domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in femur, brain, lung, skeletal muscle, pancreas and testis. {ECO:0000269|PubMed:8670277}.

Sequence

MAHVPARTSPGPGPQLLLLLLPLFLLLLRDVAGSHRAPAWSALPAAADGLQGDRDLQRHP
GDAAATLGPSAQDMVAVHMHRLYEKYSRQGARPGGGNTVRSFRARLEVVDQKAVYFFNLT
SMQDSEMILTATFHFYSEPPRWPRALEVLCKPRAKNASGRPLPLGPPTRQHLLFRSLSQN
TATQGLLRGAMALAPPPRGLWQAKDISPIVKAARRDGELLLSAQLDSEERDPGVPRPSPY
APYILVYANDLAISEPNSVAVTLQRYDPFPAGDPEPRAAPNNSADPRVRRAAQATGPLQD
NELPGLDERPPRAHAQHFHKHQLWPSPFRALKPRPGRKDRRKKGQEVFMAASQVLDFDEK
TMQKARRKQWDEPRVCSRRYLKVDFADIGWNEWIISPKSFDAYYCAGACEFPMPKIVRPS
NHATIQSIVRAVGIIPGIPEPCCVPDKMNSLGVLFLDENRNVVLKVYPNMSVDTCACR

Sequence length

478

Interactions

View interactions

	KEGG
	Cytokine-cytokine receptor interaction

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Hypertension	Hypertension, Hypertension (confirmatory factor analysis Factor 12)	N/A	N/A	GWAS

Show/Hide Text Mining Associations (23)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Adenocarcinoma of Lung	Associate	26356813, 38111060
Angiomyolipoma	Associate	22791333
Arthritis Rheumatoid	Associate	15059280, 16464743
Breast Neoplasms	Associate	23180569, 24337772
Carcinoma Non Small Cell Lung	Associate	16175182, 35422093
Colorectal Neoplasms	Associate	21365634
COVID 19	Associate	40253079
Glioblastoma	Associate	21649900
Hepatitis C	Associate	25265476
Hypoxia	Associate	19018773, 36208715
Idiopathic Pulmonary Fibrosis	Stimulate	34209019
Leukopenia	Associate	33280276
Liver Cirrhosis	Associate	25265476
Liver Diseases	Stimulate	25265476
Lung Neoplasms	Associate	11571631, 16175182
Lymphoma Non Hodgkin	Associate	32545905
Melanoma	Associate	30550954
Neoplasms	Associate	11571631, 33657265
Neoplasms	Inhibit	16175182, 35422093
Obesity	Associate	37529611
Placenta Diseases	Associate	36591257
Rectal Neoplasms	Associate	21387313
Squamous Cell Carcinoma of Head and Neck	Associate	33657265

GDF10 (growth differentiation factor 10)