Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	26585
Gene name Gene Name - the full gene name approved by the HGNC.	Gremlin 1, DAN family BMP antagonist
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	GREM1
Synonyms (NCBI Gene) Gene synonyms aliases	C15DUPq, CKTSF1B1, CRAC1, CRCS4, DAND2, DRM, DUP15q, GREMLIN, HMPS, HMPS1, IHG-2, MPSH, PIG2
Chromosome Chromosome number	15
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	15q13.3
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the BMP (bone morphogenic protein) antagonist family. Like BMPs, BMP antagonists contain cystine knots and typically form homo- and heterodimers. The CAN (cerberus and dan) subfamily of BMP antagonists, to which this gene bel

Show/Hide all(234)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022737	hsa-miR-124-3p	Microarray	18668037
MIRT617207	hsa-miR-8485	HITS-CLIP	23824327
MIRT617206	hsa-miR-603	HITS-CLIP	23824327
MIRT617205	hsa-miR-300	HITS-CLIP	23824327
MIRT617204	hsa-miR-381-3p	HITS-CLIP	23824327
MIRT617203	hsa-miR-4666a-3p	HITS-CLIP	23824327
MIRT617202	hsa-miR-511-3p	HITS-CLIP	23824327
MIRT617201	hsa-miR-6740-5p	HITS-CLIP	23824327
MIRT617200	hsa-let-7a-3p	HITS-CLIP	23824327
MIRT617199	hsa-let-7b-3p	HITS-CLIP	23824327
MIRT617198	hsa-let-7f-1-3p	HITS-CLIP	23824327
MIRT617197	hsa-miR-98-3p	HITS-CLIP	23824327
MIRT444030	hsa-miR-100-3p	HITS-CLIP	23824327
MIRT444029	hsa-miR-4778-3p	HITS-CLIP	23824327
MIRT444027	hsa-miR-4659a-3p	HITS-CLIP	23824327
MIRT444026	hsa-miR-4659b-3p	HITS-CLIP	23824327
MIRT444030	hsa-miR-100-3p	PAR-CLIP	22100165
MIRT444029	hsa-miR-4778-3p	PAR-CLIP	22100165
MIRT444028	hsa-miR-203a-3p	PAR-CLIP	22100165
MIRT444027	hsa-miR-4659a-3p	PAR-CLIP	22100165
MIRT444026	hsa-miR-4659b-3p	PAR-CLIP	22100165
MIRT734354	hsa-miR-3679-5p	Luciferase reporter assay	32597574
MIRT734355	hsa-miR-6515-5p	Luciferase reporter assay	32597574
MIRT734356	hsa-miR-6747-5p	Luciferase reporter assay	32597574
MIRT735827	hsa-miR-182-5p	Luciferase reporter assay, qRT-PCR	33962391
MIRT735828	hsa-miR-212-5p	Luciferase reporter assay, qRT-PCR	33962391
MIRT735829	hsa-miR-221-5p	Luciferase reporter assay, qRT-PCR	33962391
MIRT735830	hsa-miR-3128	Luciferase reporter assay, qRT-PCR	33962391
MIRT736091	hsa-miR-4793-3p	Luciferase reporter assay, Western blotting, qRT-PCR	33335583
MIRT617207	hsa-miR-8485	HITS-CLIP	23824327
MIRT617206	hsa-miR-603	HITS-CLIP	23824327
MIRT617205	hsa-miR-300	HITS-CLIP	23824327
MIRT617204	hsa-miR-381-3p	HITS-CLIP	23824327
MIRT617203	hsa-miR-4666a-3p	HITS-CLIP	23824327
MIRT617202	hsa-miR-511-3p	HITS-CLIP	23824327
MIRT617201	hsa-miR-6740-5p	HITS-CLIP	23824327
MIRT617200	hsa-let-7a-3p	HITS-CLIP	23824327
MIRT617199	hsa-let-7b-3p	HITS-CLIP	23824327
MIRT617198	hsa-let-7f-1-3p	HITS-CLIP	23824327
MIRT617197	hsa-miR-98-3p	HITS-CLIP	23824327
MIRT444030	hsa-miR-100-3p	HITS-CLIP	23824327
MIRT444029	hsa-miR-4778-3p	HITS-CLIP	23824327
MIRT444027	hsa-miR-4659a-3p	HITS-CLIP	23824327
MIRT444026	hsa-miR-4659b-3p	HITS-CLIP	23824327
MIRT444030	hsa-miR-100-3p	PAR-CLIP	22100165
MIRT444029	hsa-miR-4778-3p	PAR-CLIP	22100165
MIRT444028	hsa-miR-203a-3p	PAR-CLIP	22100165
MIRT444027	hsa-miR-4659a-3p	PAR-CLIP	22100165
MIRT444026	hsa-miR-4659b-3p	PAR-CLIP	22100165
MIRT1033735	hsa-miR-4330	CLIP-seq
MIRT1033736	hsa-miR-4711-5p	CLIP-seq
MIRT1033737	hsa-miR-548u	CLIP-seq
MIRT1033738	hsa-miR-2909	CLIP-seq
MIRT1033739	hsa-miR-3140-3p	CLIP-seq
MIRT1033740	hsa-miR-340	CLIP-seq
MIRT1033741	hsa-miR-4652-3p	CLIP-seq
MIRT1033742	hsa-miR-4775	CLIP-seq
MIRT1033743	hsa-miR-651	CLIP-seq
MIRT2006582	hsa-miR-1	CLIP-seq
MIRT2006583	hsa-miR-1224-5p	CLIP-seq
MIRT2006584	hsa-miR-206	CLIP-seq
MIRT2006585	hsa-miR-3915	CLIP-seq
MIRT2006586	hsa-miR-3928	CLIP-seq
MIRT2006587	hsa-miR-4446-5p	CLIP-seq
MIRT2006588	hsa-miR-4689	CLIP-seq
MIRT2006589	hsa-miR-4691-5p	CLIP-seq
MIRT2006590	hsa-miR-4755-5p	CLIP-seq
MIRT2006591	hsa-miR-526b	CLIP-seq
MIRT2006592	hsa-miR-613	CLIP-seq
MIRT2238999	hsa-miR-4427	CLIP-seq
MIRT2239000	hsa-miR-7	CLIP-seq
MIRT2450735	hsa-miR-103a	CLIP-seq
MIRT2450736	hsa-miR-107	CLIP-seq
MIRT2450737	hsa-miR-1224-3p	CLIP-seq
MIRT2450738	hsa-miR-1260	CLIP-seq
MIRT2450739	hsa-miR-1260b	CLIP-seq
MIRT2450740	hsa-miR-1280	CLIP-seq
MIRT2450741	hsa-miR-150	CLIP-seq
MIRT2450742	hsa-miR-204	CLIP-seq
MIRT2450743	hsa-miR-211	CLIP-seq
MIRT2450744	hsa-miR-3124-3p	CLIP-seq
MIRT2450745	hsa-miR-4257	CLIP-seq
MIRT2006587	hsa-miR-4446-5p	CLIP-seq
MIRT2450746	hsa-miR-4480	CLIP-seq
MIRT2450747	hsa-miR-4713-5p	CLIP-seq
MIRT2450748	hsa-miR-4717-5p	CLIP-seq
MIRT2006590	hsa-miR-4755-5p	CLIP-seq
MIRT2450749	hsa-miR-4768-5p	CLIP-seq
MIRT2450750	hsa-miR-532-3p	CLIP-seq
MIRT2450751	hsa-miR-623	CLIP-seq
MIRT2450752	hsa-miR-942	CLIP-seq
MIRT2542915	hsa-miR-101	CLIP-seq
MIRT2542916	hsa-miR-1184	CLIP-seq
MIRT2542917	hsa-miR-1205	CLIP-seq
MIRT2542918	hsa-miR-1207-3p	CLIP-seq
MIRT2542919	hsa-miR-1236	CLIP-seq
MIRT2542920	hsa-miR-1253	CLIP-seq
MIRT2542921	hsa-miR-1256	CLIP-seq
MIRT2542922	hsa-miR-1265	CLIP-seq
MIRT2542923	hsa-miR-1271	CLIP-seq
MIRT2542924	hsa-miR-1279	CLIP-seq
MIRT2542925	hsa-miR-1282	CLIP-seq
MIRT2542926	hsa-miR-1298	CLIP-seq
MIRT2542927	hsa-miR-139-5p	CLIP-seq
MIRT2542928	hsa-miR-144	CLIP-seq
MIRT2542929	hsa-miR-155	CLIP-seq
MIRT2542930	hsa-miR-181a	CLIP-seq
MIRT2542931	hsa-miR-181b	CLIP-seq
MIRT2542932	hsa-miR-181c	CLIP-seq
MIRT2542933	hsa-miR-181d	CLIP-seq
MIRT2542934	hsa-miR-182	CLIP-seq
MIRT2542935	hsa-miR-216a	CLIP-seq
MIRT2542936	hsa-miR-3117-3p	CLIP-seq
MIRT2542937	hsa-miR-3127-5p	CLIP-seq
MIRT2542938	hsa-miR-3149	CLIP-seq
MIRT2542939	hsa-miR-3158-5p	CLIP-seq
MIRT2542940	hsa-miR-3163	CLIP-seq
MIRT2542941	hsa-miR-3169	CLIP-seq
MIRT2542942	hsa-miR-3177-5p	CLIP-seq
MIRT2542943	hsa-miR-331-3p	CLIP-seq
MIRT2542944	hsa-miR-331-5p	CLIP-seq
MIRT1033740	hsa-miR-340	CLIP-seq
MIRT2542945	hsa-miR-3613-3p	CLIP-seq
MIRT2542946	hsa-miR-3617	CLIP-seq
MIRT2542947	hsa-miR-365	CLIP-seq
MIRT2542948	hsa-miR-3664-3p	CLIP-seq
MIRT2542949	hsa-miR-3667-5p	CLIP-seq
MIRT2542950	hsa-miR-3675-3p	CLIP-seq
MIRT2542951	hsa-miR-3679-3p	CLIP-seq
MIRT2542952	hsa-miR-376c	CLIP-seq
MIRT2542953	hsa-miR-381	CLIP-seq
MIRT2542954	hsa-miR-3929	CLIP-seq
MIRT2542955	hsa-miR-4251	CLIP-seq
MIRT2450745	hsa-miR-4257	CLIP-seq
MIRT2542956	hsa-miR-4262	CLIP-seq
MIRT2542957	hsa-miR-4266	CLIP-seq
MIRT2542958	hsa-miR-4270	CLIP-seq
MIRT2542959	hsa-miR-4279	CLIP-seq
MIRT2542960	hsa-miR-4282	CLIP-seq
MIRT2542961	hsa-miR-4419b	CLIP-seq
MIRT2542962	hsa-miR-4432	CLIP-seq
MIRT2542963	hsa-miR-4436b-5p	CLIP-seq
MIRT2542964	hsa-miR-4441	CLIP-seq
MIRT2542965	hsa-miR-4478	CLIP-seq
MIRT2450746	hsa-miR-4480	CLIP-seq
MIRT2542966	hsa-miR-4528	CLIP-seq
MIRT2542967	hsa-miR-4642	CLIP-seq
MIRT1033741	hsa-miR-4652-3p	CLIP-seq
MIRT2542968	hsa-miR-4678	CLIP-seq
MIRT2542969	hsa-miR-4686	CLIP-seq
MIRT2542970	hsa-miR-4694-5p	CLIP-seq
MIRT2542971	hsa-miR-4695-5p	CLIP-seq
MIRT2542972	hsa-miR-4709-3p	CLIP-seq
MIRT2542973	hsa-miR-4719	CLIP-seq
MIRT2542974	hsa-miR-4732-3p	CLIP-seq
MIRT2542975	hsa-miR-4759	CLIP-seq
MIRT2542976	hsa-miR-4760-3p	CLIP-seq
MIRT2542977	hsa-miR-4760-5p	CLIP-seq
MIRT2542978	hsa-miR-4764-5p	CLIP-seq
MIRT2542979	hsa-miR-4779	CLIP-seq
MIRT2542980	hsa-miR-485-5p	CLIP-seq
MIRT2542981	hsa-miR-495	CLIP-seq
MIRT2542982	hsa-miR-496	CLIP-seq
MIRT2542983	hsa-miR-499-3p	CLIP-seq
MIRT2542984	hsa-miR-499a-3p	CLIP-seq
MIRT2542985	hsa-miR-499a-5p	CLIP-seq
MIRT2542986	hsa-miR-510	CLIP-seq
MIRT2542987	hsa-miR-513c	CLIP-seq
MIRT2542988	hsa-miR-514b-5p	CLIP-seq
MIRT2542989	hsa-miR-520g	CLIP-seq
MIRT2542990	hsa-miR-520h	CLIP-seq
MIRT2542991	hsa-miR-543	CLIP-seq
MIRT1033737	hsa-miR-548u	CLIP-seq
MIRT2542992	hsa-miR-568	CLIP-seq
MIRT2542993	hsa-miR-577	CLIP-seq
MIRT2542994	hsa-miR-579	CLIP-seq
MIRT2542995	hsa-miR-587	CLIP-seq
MIRT2542996	hsa-miR-600	CLIP-seq
MIRT2542997	hsa-miR-617	CLIP-seq
MIRT2542998	hsa-miR-624	CLIP-seq
MIRT2542999	hsa-miR-633	CLIP-seq
MIRT2543000	hsa-miR-641	CLIP-seq
MIRT2543001	hsa-miR-664	CLIP-seq
MIRT2543002	hsa-miR-665	CLIP-seq
MIRT2239000	hsa-miR-7	CLIP-seq
MIRT2543003	hsa-miR-802	CLIP-seq
MIRT2543004	hsa-miR-873	CLIP-seq
MIRT2543005	hsa-miR-96	CLIP-seq
MIRT2542915	hsa-miR-101	CLIP-seq
MIRT2542916	hsa-miR-1184	CLIP-seq
MIRT2542917	hsa-miR-1205	CLIP-seq
MIRT2542918	hsa-miR-1207-3p	CLIP-seq
MIRT2542920	hsa-miR-1253	CLIP-seq
MIRT2542922	hsa-miR-1265	CLIP-seq
MIRT2542927	hsa-miR-139-5p	CLIP-seq
MIRT2542928	hsa-miR-144	CLIP-seq
MIRT2542935	hsa-miR-216a	CLIP-seq
MIRT2542936	hsa-miR-3117-3p	CLIP-seq
MIRT2542939	hsa-miR-3158-5p	CLIP-seq
MIRT2542941	hsa-miR-3169	CLIP-seq
MIRT1033740	hsa-miR-340	CLIP-seq
MIRT2542945	hsa-miR-3613-3p	CLIP-seq
MIRT2542946	hsa-miR-3617	CLIP-seq
MIRT2542948	hsa-miR-3664-3p	CLIP-seq
MIRT2542952	hsa-miR-376c	CLIP-seq
MIRT2542954	hsa-miR-3929	CLIP-seq
MIRT2542955	hsa-miR-4251	CLIP-seq
MIRT2542957	hsa-miR-4266	CLIP-seq
MIRT2542959	hsa-miR-4279	CLIP-seq
MIRT2542961	hsa-miR-4419b	CLIP-seq
MIRT2542963	hsa-miR-4436b-5p	CLIP-seq
MIRT2542965	hsa-miR-4478	CLIP-seq
MIRT1033741	hsa-miR-4652-3p	CLIP-seq
MIRT2542971	hsa-miR-4695-5p	CLIP-seq
MIRT2542972	hsa-miR-4709-3p	CLIP-seq
MIRT2542975	hsa-miR-4759	CLIP-seq
MIRT2542977	hsa-miR-4760-5p	CLIP-seq
MIRT2542978	hsa-miR-4764-5p	CLIP-seq
MIRT2542979	hsa-miR-4779	CLIP-seq
MIRT2542980	hsa-miR-485-5p	CLIP-seq
MIRT2542981	hsa-miR-495	CLIP-seq
MIRT2542985	hsa-miR-499a-5p	CLIP-seq
MIRT2542986	hsa-miR-510	CLIP-seq
MIRT2542987	hsa-miR-513c	CLIP-seq
MIRT2542988	hsa-miR-514b-5p	CLIP-seq
MIRT2542994	hsa-miR-579	CLIP-seq
MIRT2542995	hsa-miR-587	CLIP-seq
MIRT2542996	hsa-miR-600	CLIP-seq
MIRT2542997	hsa-miR-617	CLIP-seq
MIRT2543000	hsa-miR-641	CLIP-seq
MIRT2543002	hsa-miR-665	CLIP-seq
MIRT2239000	hsa-miR-7	CLIP-seq
MIRT2543003	hsa-miR-802	CLIP-seq
MIRT2543004	hsa-miR-873	CLIP-seq

Show/Hide all(74)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000902	Process	Cell morphogenesis	IDA	16545136
GO:0001525	Process	Angiogenesis	IEA
GO:0002042	Process	Cell migration involved in sprouting angiogenesis	IEA
GO:0002092	Process	Positive regulation of receptor internalization	IEA
GO:0002092	Process	Positive regulation of receptor internalization	ISS	9660951
GO:0003337	Process	Mesenchymal to epithelial transition involved in metanephros morphogenesis	IEA
GO:0005125	Function	Cytokine activity	IEA
GO:0005515	Function	Protein binding	IPI	16545136, 20660291, 27036124, 32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0005615	Component	Extracellular space	NAS	9660951
GO:0007165	Process	Signal transduction	IEA
GO:0007165	Process	Signal transduction	ISS
GO:0007267	Process	Cell-cell signaling	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	16545136
GO:0009887	Process	Animal organ morphogenesis	IEA
GO:0009954	Process	Proximal/distal pattern formation	IEA
GO:0009986	Component	Cell surface	IEA
GO:0010717	Process	Regulation of epithelial to mesenchymal transition	IMP	16816361
GO:0016015	Function	Morphogen activity	ISS	9660951
GO:0030199	Process	Collagen fibril organization	IMP	15539560
GO:0030297	Function	Transmembrane receptor protein tyrosine kinase activator activity	IEA
GO:0030297	Function	Transmembrane receptor protein tyrosine kinase activator activity	ISS
GO:0030326	Process	Embryonic limb morphogenesis	IEA
GO:0030502	Process	Negative regulation of bone mineralization	IMP	15539560
GO:0030514	Process	Negative regulation of BMP signaling pathway	IDA	15539560
GO:0030514	Process	Negative regulation of BMP signaling pathway	IEA
GO:0030514	Process	Negative regulation of BMP signaling pathway	IMP	16816361, 27036124
GO:0031012	Component	Extracellular matrix	HDA	28327460
GO:0031012	Component	Extracellular matrix	HDA	25037231
GO:0032331	Process	Negative regulation of chondrocyte differentiation	IMP	10556075
GO:0032872	Process	Regulation of stress-activated MAPK cascade	ISS	9660951
GO:0033689	Process	Negative regulation of osteoblast proliferation	IMP	15539560
GO:0036122	Function	BMP binding	IBA
GO:0036122	Function	BMP binding	IDA	27036124
GO:0036122	Function	BMP binding	ISS	9660951
GO:0038098	Process	Sequestering of BMP from receptor via BMP binding	IBA
GO:0042803	Function	Protein homodimerization activity	IPI	27036124
GO:0043066	Process	Negative regulation of apoptotic process	IMP	10556075
GO:0043184	Function	Vascular endothelial growth factor receptor 2 binding	IEA
GO:0043184	Function	Vascular endothelial growth factor receptor 2 binding	ISS	9660951
GO:0043542	Process	Endothelial cell migration	IEA
GO:0045668	Process	Negative regulation of osteoblast differentiation	IMP	27036124
GO:0045668	Process	Negative regulation of osteoblast differentiation	ISS	27910957
GO:0045766	Process	Positive regulation of angiogenesis	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS	9660951
GO:0046851	Process	Negative regulation of bone remodeling	IMP	15539560
GO:0048018	Function	Receptor ligand activity	IBA
GO:0048018	Function	Receptor ligand activity	IEA
GO:0048018	Function	Receptor ligand activity	ISS	9660951
GO:0048263	Process	Determination of dorsal identity	IMP	9660951
GO:0051893	Process	Regulation of focal adhesion assembly	IEA
GO:0055007	Process	Cardiac muscle cell differentiation	IEA
GO:0055007	Process	Cardiac muscle cell differentiation	ISS	9660951
GO:0060173	Process	Limb development	IMP	10556075
GO:0060379	Process	Cardiac muscle cell myoblast differentiation	IEA
GO:0060392	Process	Negative regulation of SMAD protein signal transduction	IDA	15539560
GO:0060676	Process	Ureteric bud formation	IEA
GO:0072331	Process	Signal transduction by p53 class mediator	ISS	9660951
GO:0090027	Process	Negative regulation of monocyte chemotaxis	ISS
GO:0090050	Process	Positive regulation of cell migration involved in sprouting angiogenesis	IEA
GO:0090050	Process	Positive regulation of cell migration involved in sprouting angiogenesis	ISS	9660951
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IDA	15539560
GO:0090190	Process	Positive regulation of branching involved in ureteric bud morphogenesis	IEA
GO:0090291	Process	Negative regulation of osteoclast proliferation	IMP	15539560
GO:1900155	Process	Negative regulation of bone trabecula formation	IMP	15539560
GO:1900158	Process	Negative regulation of bone mineralization involved in bone maturation	IMP	15539560
GO:1900748	Process	Positive regulation of vascular endothelial growth factor signaling pathway	IEA
GO:1900748	Process	Positive regulation of vascular endothelial growth factor signaling pathway	ISS	9660951
GO:1901224	Process	Positive regulation of non-canonical NF-kappaB signal transduction	IEA

MIM	HGNC	e!Ensembl
603054	2001	ENSG00000166923

Protein

UniProt ID

O60565

Protein name

Gremlin-1 (Cell proliferation-inducing gene 2 protein) (Cysteine knot superfamily 1, BMP antagonist 1) (DAN domain family member 2) (Down-regulated in Mos-transformed cells protein) (Increased in high glucose protein 2) (IHG-2)

Protein function

Cytokine that may play an important role during carcinogenesis and metanephric kidney organogenesis, as a BMP antagonist required for early limb outgrowth and patterning in maintaining the FGF4-SHH feedback loop. Down-regulates the BMP4 signalin

PDB

5AEJ , 8B7H

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03045	DAN	71 → 181	DAN domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in small intestine, fetal brain and colon. Expression is restricted to intestinal subepithelial myofibroblasts (ISEMFs) at the crypt base. In subjects with HMPS1, by contrast, GREM1 is expressed, not only in basal ISEM

Sequence

MSRTAYTVGALLLLLGTLLPAAEGKKKGSQGAIPPPDKAQHNDSEQTQSPQQPGSRNRGR
GQGRGTAMPGEEVLESSQEALHVTERKYLKRDWCKTQPLKQTIHEEGCNSRTIINRFCYG
QCNSFYIPRHIRKEEGSFQSCSFCKPKKFTTMMVTLNCPELQPPTKKKRVTRVKQCRCIS
IDLD

Sequence length

184

Interactions

View interactions

	KEGG
	TGF-beta signaling pathway

Show/Hide Unknown Diseases (6)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Colorectal Cancer	Early onset colorectal cancer, Colorectal cancer, Colorectal cancer (SNP x SNP interaction), Colorectal cancer (PheCode 153), ICD10 C18, C19, C20: colorectal cancer	N/A	N/A	GWAS
colorectal cancer	Familial colorectal cancer	N/A	N/A	ClinVar
Hereditary Mixed Polyposis Syndrome	hereditary mixed polyposis syndrome	N/A	N/A	ClinVar, GenCC
Hereditary mixed polyposis syndrome	polyposis syndrome, hereditary mixed, 1	N/A	N/A	GenCC
Hypospadias	Hypospadias	N/A	N/A	GWAS
Pelvic Organ Prolapse	Pelvic organ prolapse	N/A	N/A	GWAS

Show/Hide Text Mining Associations (108)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Acute Coronary Syndrome	Stimulate	27101443
Adenocarcinoma of Lung	Stimulate	22870311
Adenocarcinoma of Lung	Associate	32381040
Adenoma	Associate	12117880, 23155391, 23748100
Adenomatous Polyposis Coli	Associate	23805267, 32170005
Albuminuria	Associate	19577778
Alzheimer Disease	Associate	22870311
Angina Stable	Stimulate	27101443
Anti Neutrophil Cytoplasmic Antibody Associated Vasculitis	Associate	31053735
Attenuated familial adenomatous polyposis	Associate	26493165
Atypical Squamous Cells of the Cervix	Associate	32096207
Breast Neoplasms	Associate	27449045, 30236106, 32141512
Cap Myopathy	Associate	29453410
Carcinogenesis	Associate	22561515, 26392110
Carcinoma Basal Cell	Associate	17003113, 28346486
Carcinoma Hepatocellular	Associate	22839096, 23826422
Carcinoma Intraductal Noninfiltrating	Associate	30236106
Carcinoma Non Small Cell Lung	Stimulate	26392110
Carcinoma Renal Cell	Associate	20042676, 20154727
Carcinoma Squamous Cell	Stimulate	28346486
Carcinoma Transitional Cell	Associate	34456216
Cleft Lip	Associate	29489415
Cleft Palate	Associate	29489415
Cleft Soft Palate	Associate	29489415
Colitis Ulcerative	Stimulate	33506258
Colitis Ulcerative	Associate	38070204
Colonic Neoplasms	Associate	32583331
Colonic Polyps	Associate	25992589, 29804199
Colorectal Neoplasms	Associate	12696020, 17923762, 20659471, 21655089, 22367214, 22505654, 23155391, 23659962, 24753543, 24812030, 25992589, 26208990, 26493165, 26947005, 29504907 View all (10 more)
Colorectal Neoplasms Hereditary Nonpolyposis	Associate	25992589, 29804199
Diabetes Mellitus	Associate	19577778, 37365645
Diabetes Mellitus	Stimulate	27101443
Diabetes Mellitus Type 2	Stimulate	27101443
Diabetes Mellitus Type 2	Associate	35893034
Diabetic Foot	Associate	37365645
Diabetic Nephropathies	Associate	20150533, 25378054, 26412030
Diabetic Nephropathies	Stimulate	31053735
Endometriosis	Stimulate	18314105
Endometriosis	Associate	38115253
Esophageal Neoplasms	Associate	29953975
Esophageal Squamous Cell Carcinoma	Stimulate	29953975
Fibroma Desmoplastic	Stimulate	24812030
Fibrosis	Associate	22839096, 24949470, 31053735, 37240308
Glaucoma	Associate	23748100
Glioblastoma	Associate	23826422
Glomerulonephritis	Associate	31053735
Glucosephosphate Dehydrogenase Deficiency	Associate	28522681
Heart Failure	Associate	32618141
Hepatitis C Chronic	Associate	22839096
Hereditary Breast and Ovarian Cancer Syndrome	Associate	16545136
Hypospadias	Associate	33962391
Hypoxia	Stimulate	20336693, 28522681
Idiopathic Pulmonary Fibrosis	Stimulate	16816361
Infertility	Associate	22160428
Inflammation	Associate	31053735, 37365645, 38070204
Inflammatory Bowel Diseases	Associate	33506258
Intervertebral Disc Degeneration	Associate	37700277
Intestinal Polyposis	Associate	23805267, 26947005
Juvenile polyposis syndrome	Associate	22561515
Kidney Diseases	Associate	20150533, 31053735
Kidney Failure Chronic	Associate	22505654
Kidney Failure Chronic	Stimulate	26412030
Lead Poisoning Nervous System	Associate	27713170
Loeys Dietz Syndrome	Stimulate	25116393
Lung Diseases	Associate	28522681
Lung Neoplasms	Associate	16234815, 34671675
Lymphatic Metastasis	Stimulate	31882551
Lymphoma B Cell	Associate	23826422
Melanoma	Stimulate	28346486
Mesothelioma Malignant	Associate	25757056
Microsatellite Instability	Associate	26493165
Myotonic Dystrophy	Stimulate	27101443
Nasopharyngeal Carcinoma	Associate	37365917
Negative rheumatoid factor polyarthritis	Associate	12696020
Neoplasm Metastasis	Associate	35883579
Neoplasms	Associate	12117880, 16234815, 16545136, 17003113, 20154727, 22514712, 22870311, 23155391, 23659962, 23800187, 23826422, 24299561, 26531827, 27931212, 28346486 View all (8 more)
Neoplasms	Inhibit	20042676
Neuroblastoma	Associate	22160428, 27036124
Obesity	Associate	34296200
Orofacial Cleft 1	Associate	38002937
Osteoarthritis	Stimulate	27794162
Osteoarthritis	Associate	37140355
Osteoarthritis Knee	Stimulate	27794162
Ovarian Diseases	Inhibit	22160428
Pancreatic Neoplasms	Associate	30272371
Pilomatrixoma	Associate	28346486
Polyposis Syndrome Hereditary Mixed 1	Associate	12696020, 18313025, 22561515, 23805267, 25992589, 29804199
Prostatic Neoplasms	Associate	16234815
Prostatitis	Associate	37240308
Pulmonary Arterial Hypertension	Associate	28522681
Renal Insufficiency Chronic	Stimulate	24949470
Renal Insufficiency Chronic	Associate	31053735
Rhabdomyosarcoma Alveolar	Stimulate	23733015
Rhabdomyosarcoma Embryonal	Associate	23733015
Sarcoma	Stimulate	26531827
Simpson Golabi Behmel syndrome	Associate	22286531
Skin Diseases	Inhibit	27713170
Skin Neoplasms	Stimulate	28346486
Squamous Cell Carcinoma of Head and Neck	Associate	18254958, 27931212
Stomach Neoplasms	Associate	16367923, 29396725, 31882551
Tachycardia Atrioventricular Nodal Reentry	Associate	29396725
Triple Negative Breast Neoplasms	Associate	23700430
Ulcer	Associate	37365645
Urinary Bladder Neoplasms	Associate	37605239, 39375386
Uterine Cervical Neoplasms	Stimulate	16545136
Van der Woude syndrome	Associate	29489415
Vesico Ureteral Reflux	Associate	22558067
White Dot Syndromes	Associate	31700227

GREM1 (gremlin 1, DAN family BMP antagonist)