MYEOV (myeloma overexpressed)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
26579
Gene name Gene Name - the full gene name approved by the HGNC.
Myeloma overexpressed
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
MYEOV
Synonyms (NCBI Gene) Gene synonyms aliases
OCIM
Chromosome Chromosome number
11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
11q13.3
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(24)
miRTarBase ID miRNA Experiments Reference
MIRT025839 hsa-miR-7-5p Microarray 19073608
MIRT734372 hsa-miR-490-5p Luciferase reporter assay, Western blotting, qRT-PCR 31894478
MIRT1168065 hsa-miR-103a CLIP-seq
MIRT1168066 hsa-miR-107 CLIP-seq
MIRT1168067 hsa-miR-1184 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(1)
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183, 32814053
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
605625 7563 ENSG00000172927
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Q96EZ4
Protein name Myeloma-overexpressed gene protein (Oncogene in multiple myeloma)
Family and domains
Sequence 
MALRICVTYTPALPIGLCTRCCLCLEQSPSWCHCLRGVSFLTFHLHQSVPLGDRDSLLMF
TRQAGHFVEGSKAGRSRGRLCLSQALRVAVRGAFVSLWFAAGAGDRERNKGDKGAQTGAG
LSQEAEDVDVSRARRVTDAPQGTLCGTGNRNSGSQSARVVGVAHLGEAFRVGVEQAISSC
PEEVHGRHGLSMEIMWARMDVALRSPGRGLLAGAGALCMTLAESSCPDYERGRRACLTLH
RHPTPHCSTWGLPLRVAGSWLTVVTVEALGGWRMGVRRTGQVGPTMHPPPVSGASPLLLH
HLLLLLLIIILTC
Sequence length 313
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Intracranial aneurysm Intracranial Aneurysm rs1594095223 30823506
Show/Hide Unknown Diseases (5)
Unknown
Disease term Disease name Evidence References Source
Prostate cancer Prostate cancer Together, these results show that PRRX2 is an oncogene and might play a role in the aggressiveness of PC within the DNPC population. GWAS, CBGDA
Diabetes Diabetes GWAS
Acne Acne GWAS
Intracranial Aneurysm Intracranial Aneurysm GWAS
Show/Hide Text Mining Associations (20)
Associations from Text Mining
Disease Name Relationship Type References
Acidosis Associate 34993253
Carcinoma Hepatocellular Associate 31828095
Carcinoma Non Small Cell Lung Associate 28698358
Carcinoma Pancreatic Ductal Associate 32420813, 34789165, 34930894
Colorectal Neoplasms Stimulate 20569498
Colorectal Neoplasms Associate 35395711
Emanuel syndrome Associate 10753852
Esophageal Squamous Cell Carcinoma Associate 18405350, 34962019
Immunoglobulin Light chain Amyloidosis Associate 28341732
Lung Neoplasms Associate 28698358