Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
26579
Gene name Gene Name - the full gene name approved by the HGNC.
Myeloma overexpressed
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
MYEOV
Synonyms (NCBI Gene) Gene synonyms aliases
OCIM
Chromosome Chromosome number
11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
11q13.3
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT025839 hsa-miR-7-5p Microarray 19073608
MIRT734372 hsa-miR-490-5p Luciferase reporter assay, Western blotting, qRT-PCR 31894478
MIRT1168065 hsa-miR-103a CLIP-seq
MIRT1168066 hsa-miR-107 CLIP-seq
MIRT1168067 hsa-miR-1184 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 28514442, 32296183, 32814053, 33961781
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
605625 7563 ENSG00000172927
Protein
UniProt ID Q96EZ4
Protein name Myeloma-overexpressed gene protein (Oncogene in multiple myeloma)
Family and domains
Sequence
MALRICVTYTPALPIGLCTRCCLCLEQSPSWCHCLRGVSFLTFHLHQSVPLGDRDSLLMF
TRQAGHFVEGSKAGRSRGRLCLSQALRVAVRGAFVSLWFAAGAGDRERNKGDKGAQTGAG
LSQEAEDVDVSRARRVTDAPQGTLCGTGNRNSGSQSARVVGVAHLGEAFRVGVEQAISSC
PEEVHGRHGLSMEIMWARMDVALRSPGRGLLAGAGALCMTLAESSCPDYERGRRACLTLH
RHPTPHCSTWGLPLRVAGSWLTVVTVEALGGWRMGVRRTGQVGPTMHPPPVSGASPLLLH
HLLLLLLIIILTC
Sequence length 313
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Acne acne vulgaris N/A N/A GWAS
Atrial Fibrillation Atrial fibrillation N/A N/A GWAS
Diabetes Type 2 diabetes N/A N/A GWAS
Intracranial Aneurysm Intracranial aneurysm N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Acidosis Associate 34993253
Carcinoma Hepatocellular Associate 31828095
Carcinoma Non Small Cell Lung Associate 28698358
Carcinoma Pancreatic Ductal Associate 32420813, 34789165, 34930894
Colorectal Neoplasms Stimulate 20569498
Colorectal Neoplasms Associate 35395711
Emanuel syndrome Associate 10753852
Esophageal Squamous Cell Carcinoma Associate 18405350, 34962019
Immunoglobulin Light chain Amyloidosis Associate 28341732
Lung Neoplasms Associate 28698358