Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
26528
Gene name Gene Name - the full gene name approved by the HGNC.
DAZ associated protein 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
DAZAP1
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
19p13.3
Summary Summary of gene provided in NCBI Entrez Gene.
In mammals, the Y chromosome directs the development of the testes and plays an important role in spermatogenesis. A high percentage of infertile men have deletions that map to regions of the Y chromosome. The DAZ (deleted in azoospermia) gene cluster map
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT048966 hsa-miR-92a-3p CLASH 23622248
MIRT048966 hsa-miR-92a-3p CLASH 23622248
MIRT048966 hsa-miR-92a-3p CLASH 23622248
MIRT046606 hsa-miR-222-3p CLASH 23622248
MIRT046606 hsa-miR-222-3p CLASH 23622248
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001673 Component Male germ cell nucleus IEA
GO:0001893 Process Maternal placenta development IEA
GO:0003676 Function Nucleic acid binding IEA
GO:0003723 Function RNA binding HDA 22658674, 22681889
GO:0003723 Function RNA binding IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
607430 2683 ENSG00000071626
Protein
UniProt ID Q96EP5
Protein name DAZ-associated protein 1 (Deleted in azoospermia-associated protein 1)
Protein function RNA-binding protein, which may be required during spermatogenesis.
PDB 2DGS , 2DH8
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00076 RRM_1 12 81 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Domain
PF00076 RRM_1 115 184 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Domain
Tissue specificity TISSUE SPECIFICITY: Mainly expressed in testis. Expressed to a lower level in thymus. Weakly or not expressed in heart, liver, brain, placenta, lung, skeletal muscle, kidney and pancreas. {ECO:0000269|PubMed:10857750}.
Sequence
MNNSGADEIGKLFVGGLDWSTTQETLRSYFSQYGEVVDCVIMKDKTTNQSRGFGFVKFKD
PNCVGTVLASRPHTLDGRNID
PKPCTPRGMQPERTRPKEGWQKGPRSDNSKSNKIFVGGI
PHNCGETELREYFKKFGVVTEVVMIYDAEKQRPRGFGFITFEDEQSVDQAVNMHFHDIMG
KKVE
VKRAEPRDSKSQAPGQPGASQWGSRVVPNAANGWAGQPPPTWQQGYGPQGMWVPAG
QAIGGYGPPPAGRGAPPPPPPFTSYIVSTPPGGFPPPQGFPQGYGAPPQFSFGYGPPPPP
PDQFAPPGVPPPPATPGAAPLAFPPPPSQAAPDMSKPPTAQPDFPYGQYAGYGQDLSGFG
QGFSDPSQQPPSYGGPSVPGSGGPPAGGSGFGRGQNHNVQGFHPYRR
Sequence length 407
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  
  mRNA surveillance pathway  
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Alzheimer disease Alzheimer's disease or family history of Alzheimer's disease N/A N/A GWAS
B-Cell Lymphocytosis monoclonal b-cell lymphocytosis N/A N/A ClinVar
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Esophageal Squamous Cell Carcinoma Associate 32308763
Lymphoma Mantle Cell Associate 32584970
Multiple Myeloma Stimulate 36242590
Muscular Dystrophy Duchenne Associate 25662218
Neoplasms Inhibit 32308763
Neoplasms Stimulate 36242590
Osteoarthritis Associate 37507717
Prehypertension Associate 15182431
Retinoblastoma Associate 33525094
Synovitis Associate 29968759