Gene Gene information from NCBI Gene database.
Entrez ID 26528
Gene name DAZ associated protein 1
Gene symbol DAZAP1
Synonyms (NCBI Gene)
-
Chromosome 19
Chromosome location 19p13.3
Summary In mammals, the Y chromosome directs the development of the testes and plays an important role in spermatogenesis. A high percentage of infertile men have deletions that map to regions of the Y chromosome. The DAZ (deleted in azoospermia) gene cluster map
miRNA miRNA information provided by mirtarbase database.
164
miRTarBase ID miRNA Experiments Reference
MIRT048966 hsa-miR-92a-3p CLASH 23622248
MIRT048966 hsa-miR-92a-3p CLASH 23622248
MIRT048966 hsa-miR-92a-3p CLASH 23622248
MIRT046606 hsa-miR-222-3p CLASH 23622248
MIRT046606 hsa-miR-222-3p CLASH 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
25
GO ID Ontology Definition Evidence Reference
GO:0001673 Component Male germ cell nucleus IEA
GO:0001893 Process Maternal placenta development IEA
GO:0003676 Function Nucleic acid binding IEA
GO:0003723 Function RNA binding HDA 22658674, 22681889
GO:0003723 Function RNA binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
607430 2683 ENSG00000071626
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q96EP5
Protein name DAZ-associated protein 1 (Deleted in azoospermia-associated protein 1)
Protein function RNA-binding protein, which may be required during spermatogenesis.
PDB 2DGS , 2DH8
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00076 RRM_1 12 81 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Domain
PF00076 RRM_1 115 184 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Domain
Tissue specificity TISSUE SPECIFICITY: Mainly expressed in testis. Expressed to a lower level in thymus. Weakly or not expressed in heart, liver, brain, placenta, lung, skeletal muscle, kidney and pancreas. {ECO:0000269|PubMed:10857750}.
Sequence
MNNSGADEIGKLFVGGLDWSTTQETLRSYFSQYGEVVDCVIMKDKTTNQSRGFGFVKFKD
PNCVGTVLASRPHTLDGRNID
PKPCTPRGMQPERTRPKEGWQKGPRSDNSKSNKIFVGGI
PHNCGETELREYFKKFGVVTEVVMIYDAEKQRPRGFGFITFEDEQSVDQAVNMHFHDIMG
KKVE
VKRAEPRDSKSQAPGQPGASQWGSRVVPNAANGWAGQPPPTWQQGYGPQGMWVPAG
QAIGGYGPPPAGRGAPPPPPPFTSYIVSTPPGGFPPPQGFPQGYGAPPQFSFGYGPPPPP
PDQFAPPGVPPPPATPGAAPLAFPPPPSQAAPDMSKPPTAQPDFPYGQYAGYGQDLSGFG
QGFSDPSQQPPSYGGPSVPGSGGPPAGGSGFGRGQNHNVQGFHPYRR
Sequence length 407
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG 
  mRNA surveillance pathway  
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
1
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Monoclonal B-Cell Lymphocytosis Uncertain significance rs869025246 RCV000208559
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Esophageal Squamous Cell Carcinoma Associate 32308763
Lymphoma Mantle Cell Associate 32584970
Multiple Myeloma Stimulate 36242590
Muscular Dystrophy Duchenne Associate 25662218
Neoplasms Inhibit 32308763
Neoplasms Stimulate 36242590
Osteoarthritis Associate 37507717
Prehypertension Associate 15182431
Retinoblastoma Associate 33525094
Synovitis Associate 29968759