Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	26525
Gene name Gene Name - the full gene name approved by the HGNC.	Interleukin 36 receptor antagonist
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	IL36RN
Synonyms (NCBI Gene) Gene synonyms aliases	FIL1, FIL1(DELTA), FIL1D, IL-36Ra, IL1F5, IL1HY1, IL1L1, IL1RP3, IL36RA, PSORP, PSORS14
Chromosome Chromosome number	2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	2q14.1
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine was shown to specifically inhibit the activation of NF-kappaB induced by interleukin 1 family, member 6 (IL1F6). This gene and eight other interleukin 1 famil

Show/Hide all(9)

SNP ID	Visualize variation	Clinical significance	Consequence
rs77864207	G>A	Conflicting-interpretations-of-pathogenicity	Coding sequence variant, missense variant
rs139497891	C>T	Conflicting-interpretations-of-pathogenicity, uncertain-significance	Coding sequence variant, missense variant
rs144478519	C>A,T	Conflicting-interpretations-of-pathogenicity, uncertain-significance	Missense variant, coding sequence variant, stop gained
rs148755083	T>C	Conflicting-interpretations-of-pathogenicity	Intron variant
rs151325121	C>T	Pathogenic	Missense variant, coding sequence variant
rs187015338	A>G	Pathogenic	Coding sequence variant, missense variant
rs199932303	C>T	Pathogenic	Coding sequence variant, missense variant
rs387906914	T>C	Pathogenic	Coding sequence variant, missense variant
rs397514629	C>G,T	Uncertain-significance, pathogenic	Coding sequence variant, missense variant

Show/Hide all(90)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018357	hsa-miR-335-5p	Microarray	18185580
MIRT029800	hsa-miR-26b-5p	Microarray	19088304
MIRT051062	hsa-miR-16-5p	CLASH	23622248
MIRT1064931	hsa-miR-1207-5p	CLIP-seq
MIRT1064932	hsa-miR-1224-5p	CLIP-seq
MIRT1064933	hsa-miR-1243	CLIP-seq
MIRT1064934	hsa-miR-1248	CLIP-seq
MIRT1064935	hsa-miR-1257	CLIP-seq
MIRT1064936	hsa-miR-1297	CLIP-seq
MIRT1064937	hsa-miR-1303	CLIP-seq
MIRT1064938	hsa-miR-1304	CLIP-seq
MIRT1064939	hsa-miR-2110	CLIP-seq
MIRT1064940	hsa-miR-26a	CLIP-seq
MIRT1064941	hsa-miR-26b	CLIP-seq
MIRT1064942	hsa-miR-3120-3p	CLIP-seq
MIRT1064943	hsa-miR-3129-3p	CLIP-seq
MIRT1064944	hsa-miR-3159	CLIP-seq
MIRT1064945	hsa-miR-3184	CLIP-seq
MIRT1064946	hsa-miR-326	CLIP-seq
MIRT1064947	hsa-miR-330-5p	CLIP-seq
MIRT1064948	hsa-miR-338-3p	CLIP-seq
MIRT1064949	hsa-miR-3612	CLIP-seq
MIRT1064950	hsa-miR-3614-3p	CLIP-seq
MIRT1064951	hsa-miR-3674	CLIP-seq
MIRT1064952	hsa-miR-3929	CLIP-seq
MIRT1064953	hsa-miR-423-5p	CLIP-seq
MIRT1064954	hsa-miR-4271	CLIP-seq
MIRT1064955	hsa-miR-4419b	CLIP-seq
MIRT1064956	hsa-miR-4443	CLIP-seq
MIRT1064957	hsa-miR-4463	CLIP-seq
MIRT1064958	hsa-miR-4465	CLIP-seq
MIRT1064959	hsa-miR-4478	CLIP-seq
MIRT1064960	hsa-miR-4496	CLIP-seq
MIRT1064961	hsa-miR-4530	CLIP-seq
MIRT1064962	hsa-miR-4533	CLIP-seq
MIRT1064963	hsa-miR-4637	CLIP-seq
MIRT1064964	hsa-miR-4645-3p	CLIP-seq
MIRT1064965	hsa-miR-4667-5p	CLIP-seq
MIRT1064966	hsa-miR-4700-5p	CLIP-seq
MIRT1064967	hsa-miR-4711-3p	CLIP-seq
MIRT1064968	hsa-miR-4716-3p	CLIP-seq
MIRT1064969	hsa-miR-4725-3p	CLIP-seq
MIRT1064970	hsa-miR-4736	CLIP-seq
MIRT1064971	hsa-miR-4747-5p	CLIP-seq
MIRT1064972	hsa-miR-4751	CLIP-seq
MIRT1064973	hsa-miR-4763-3p	CLIP-seq
MIRT1064974	hsa-miR-4795-5p	CLIP-seq
MIRT1064975	hsa-miR-485-5p	CLIP-seq
MIRT1064976	hsa-miR-511	CLIP-seq
MIRT1064977	hsa-miR-552	CLIP-seq
MIRT1064978	hsa-miR-637	CLIP-seq
MIRT1064979	hsa-miR-650	CLIP-seq
MIRT1064935	hsa-miR-1257	CLIP-seq
MIRT1064980	hsa-miR-125a-3p	CLIP-seq
MIRT1064938	hsa-miR-1304	CLIP-seq
MIRT1064945	hsa-miR-3184	CLIP-seq
MIRT1064981	hsa-miR-3545-5p	CLIP-seq
MIRT1064982	hsa-miR-3934	CLIP-seq
MIRT1064953	hsa-miR-423-5p	CLIP-seq
MIRT1064968	hsa-miR-4716-3p	CLIP-seq
MIRT1064983	hsa-miR-4796-3p	CLIP-seq
MIRT1064984	hsa-miR-520g	CLIP-seq
MIRT1064985	hsa-miR-520h	CLIP-seq
MIRT1064986	hsa-miR-764	CLIP-seq
MIRT1550121	hsa-miR-3652	CLIP-seq
MIRT1550122	hsa-miR-4251	CLIP-seq
MIRT1550123	hsa-miR-4329	CLIP-seq
MIRT1550124	hsa-miR-4430	CLIP-seq
MIRT1550125	hsa-miR-4459	CLIP-seq
MIRT1550126	hsa-miR-4695-5p	CLIP-seq
MIRT1064975	hsa-miR-485-5p	CLIP-seq
MIRT2015443	hsa-miR-1976	CLIP-seq
MIRT2247752	hsa-miR-3065-3p	CLIP-seq
MIRT2247753	hsa-miR-512-5p	CLIP-seq
MIRT2551387	hsa-miR-185	CLIP-seq
MIRT2551388	hsa-miR-3607-5p	CLIP-seq
MIRT2551389	hsa-miR-4306	CLIP-seq
MIRT2551390	hsa-miR-4491	CLIP-seq
MIRT2551391	hsa-miR-4644	CLIP-seq
MIRT2551392	hsa-miR-4657	CLIP-seq
MIRT2551393	hsa-miR-4725-5p	CLIP-seq
MIRT2551394	hsa-miR-504	CLIP-seq
MIRT2551387	hsa-miR-185	CLIP-seq
MIRT2551388	hsa-miR-3607-5p	CLIP-seq
MIRT2551389	hsa-miR-4306	CLIP-seq
MIRT2551390	hsa-miR-4491	CLIP-seq
MIRT2551391	hsa-miR-4644	CLIP-seq
MIRT2551392	hsa-miR-4657	CLIP-seq
MIRT2551393	hsa-miR-4725-5p	CLIP-seq
MIRT2551394	hsa-miR-504	CLIP-seq

Show/Hide all(22)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001960	Process	Negative regulation of cytokine-mediated signaling pathway	IMP	23147407
GO:0002376	Process	Immune system process	IEA
GO:0005125	Function	Cytokine activity	IEA
GO:0005149	Function	Interleukin-1 receptor binding	IEA
GO:0005152	Function	Interleukin-1 receptor antagonist activity	TAS	10512743
GO:0005515	Function	Protein binding	IPI	16189514, 25416956, 32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0006954	Process	Inflammatory response	IBA
GO:0006954	Process	Inflammatory response	IEA
GO:0006955	Process	Immune response	IBA
GO:0006955	Process	Immune response	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0019732	Process	Antifungal humoral response	IMP	23147407
GO:0032689	Process	Negative regulation of type II interferon production	IMP	23147407
GO:0032700	Process	Negative regulation of interleukin-17 production	IMP	23147407
GO:0032715	Process	Negative regulation of interleukin-6 production	IEA
GO:0045087	Process	Innate immune response	IEA
GO:0071222	Process	Cellular response to lipopolysaccharide	IBA

MIM	HGNC	e!Ensembl
605507	15561	ENSG00000136695

Protein

UniProt ID

Q9UBH0

Protein name

Interleukin-36 receptor antagonist protein (IL-36Ra) (FIL1 delta) (IL-1-related protein 3) (IL-1RP3) (Interleukin-1 HY1) (IL-1HY1) (Interleukin-1 delta) (IL-1 delta) (Interleukin-1 family member 5) (IL-1F5) (Interleukin-1 receptor antagonist homolog 1) (I

Protein function

Inhibits the activity of interleukin-36 (IL36A,IL36B and IL36G) by binding to receptor IL1RL2 and preventing its association with the coreceptor IL1RAP for signaling. Part of the IL-36 signaling system that is thought to be present in epithelial

PDB

4P0J , 4P0K , 4P0L

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00340	IL1	38 → 151	Interleukin-1 / 18	Domain

Tissue specificity

TISSUE SPECIFICITY: Predominantly expressed in skin keratinocytes but not in fibroblasts, endothelial cells or melanocytes. Detected also in the spleen, brain leukocyte and macrophage cell types. Increased in lesional psoriasis skin. {ECO:0000269|PubMed:1

Sequence

MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAGKVIKGEEISVVPNRWLDASLSPVILG
VQGGSQCLSCGVGQEPTLTLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWF
LCTVPEADQPVRLTQLPENGGWNAPITDFYFQQCD

Sequence length

155

Interactions

View interactions

	KEGG		Reactome
	Cytokine-cytokine receptor interaction		Interleukin-36 pathway

Show/Hide Causal Diseases (2)

Disease merge term	Disease name	dbSNP ID	References
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Autoinflammatory Disease	Autoinflammatory syndrome	rs148755083	N/A
Pustular Psoriasis	generalized pustular psoriasis	rs387906914, rs148755083	N/A

Show/Hide Unknown Diseases (2)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Palmoplantar Pustules	pustulosis palmaris et plantaris	N/A	N/A	GenCC
Psoriasis	psoriasis 14, pustular, Psoriasis	N/A	N/A	GenCC, GWAS

Show/Hide Text Mining Associations (21)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Achondroplasia	Associate	30036598
Acute Generalized Exanthematous Pustulosis	Associate	30395846, 38013380
Aggressive Periodontitis	Associate	30036598
Arthritis Juvenile	Associate	35325069
Castleman Disease	Associate	32303241
Chronobiology Disorders	Associate	21839423
Colitis Ulcerative	Stimulate	30643810
Diabetes Mellitus Type 2	Inhibit	33034926
Dry Eye Syndromes	Associate	34428579
Fever	Associate	32303241, 36331855
Glossitis Benign Migratory	Associate	27900482
Hypoalbuminemia	Associate	36331855
Inflammation	Associate	28194751, 33034926, 34272761, 34428579
Inflammatory Bowel Diseases	Associate	30643810
Intervertebral disc disease	Associate	28583914
Leukocytosis	Associate	36331855
Periodontitis	Inhibit	34272761
Polyradiculoneuropathy Chronic Inflammatory Demyelinating	Associate	26632693
Psoriasis	Associate	21839423, 27900482, 28194751, 30036598, 30395846, 30634937, 31286990, 31789248, 36331855
Skin Diseases	Associate	21839423
Stomach Neoplasms	Associate	26632693

IL36RN (interleukin 36 receptor antagonist)