Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
26523
Gene name Gene Name - the full gene name approved by the HGNC.
Argonaute RISC component 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
AGO1
Synonyms (NCBI Gene) Gene synonyms aliases
EIF2C, EIF2C1, GERP95, NEDLBAS, Q99, hAgo1
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1p34.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the argonaute family of proteins, which associate with small RNAs and have important roles in RNA interference (RNAi) and RNA silencing. This protein binds to microRNAs (miRNAs) or small interfering RNAs (siRNAs) and represse
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT000649 hsa-miR-503-5p Luciferase reporter assay 19956200
MIRT019395 hsa-miR-148b-3p Microarray 17612493
MIRT020233 hsa-miR-130b-3p Sequencing 20371350
MIRT020459 hsa-miR-106b-5p Microarray 17242205
MIRT028161 hsa-miR-93-5p Sequencing 20371350
Transcription factors
Transcription factor Regulation Reference
SOX4 Unknown 19147588
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000932 Component P-body IEA
GO:0000956 Process Nuclear-transcribed mRNA catabolic process IDA 18771919
GO:0000976 Function Transcription cis-regulatory region binding IEA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IEA
GO:0000993 Function RNA polymerase II complex binding IDA 25336585
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
606228 3262 ENSG00000092847
Protein
UniProt ID Q9UL18
Protein name Protein argonaute-1 (Argonaute1) (hAgo1) (Argonaute RISC catalytic component 1) (Eukaryotic translation initiation factor 2C 1) (eIF-2C 1) (eIF2C 1) (Putative RNA-binding protein Q99)
Protein function Required for RNA-mediated gene silencing (RNAi). Binds to short RNAs such as microRNAs (miRNAs) or short interfering RNAs (siRNAs), and represses the translation of mRNAs which are complementary to them. Lacks endonuclease activity and does not
PDB 1SI2 , 1SI3 , 4KRE , 4KRF , 4KXT , 5W6V
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF16486 ArgoN 34 164 N-terminal domain of argonaute Domain
PF08699 ArgoL1 174 224 Argonaute linker 1 domain Domain
PF02170 PAZ 229 363 PAZ domain Domain
PF16488 ArgoL2 372 418 Argonaute linker 2 domain Family
PF16487 ArgoMid 427 509 Mid domain of argonaute Domain
PF02171 Piwi 515 816 Piwi domain Family
Sequence
MEAGPSGAAAGAYLPPLQQVFQAPRRPGIGTVGKPIKLLANYFEVDIPKIDVYHYEVDIK
PDKCPRRVNREVVEYMVQHFKPQIFGDRKPVYDGKKNIYTVTALPIGNERVDFEVTIPGE
GKDRIFKVSIKWLAIVSWRMLHEALVSGQIPVPLESVQALDVAM
RHLASMRYTPVGRSFF
SPPEGYYHPLGGGREVWFGFHQSVRPAMWKMMLNIDVSATAFYK
AQPVIEFMCEVLDIRN
IDEQPKPLTDSQRVRFTKEIKGLKVEVTHCGQMKRKYRVCNVTRRPASHQTFPLQLESGQ
TVECTVAQYFKQKYNLQLKYPHLPCLQVGQEQKHTYLPLEVCNIVAGQRCIKKLTDNQTS
TMI
KATARSAPDRQEEISRLMKNASYNLDPYIQEFGIKVKDDMTEVTGRVLPAPILQYGG
RNRAIATPNQGVWDMRGKQFYNGIEIKVWAIACFAPQKQCREEVLKNFTDQLRKISKDAG
MPIQGQPCFCKYAQGADSVEPMFRHLKNT
YSGLQLIIVILPGKTPVYAEVKRVGDTLLGM
ATQCVQVKNVVKTSPQTLSNLCLKINVKLGGINNILVPHQRSAVFQQPVIFLGADVTHPP
AGDGKKPSITAVVGSMDAHPSRYCATVRVQRPRQEIIEDLSYMVRELLIQFYKSTRFKPT
RIIFYRDGVPEGQLPQILHYELLAIRDACIKLEKDYQPGITYIVVQKRHHTRLFCADKNE
RIGKSGNIPAGTTVDTNITHPFEFDFYLCSHAGIQGTSRPSHYYVLWDDNRFTADELQIL
TYQLCHTYVRCTRSVSIPAPAYYARLVAFRARYHLV
DKEHDSGEGSHISGQSNGRDPQAL
AKAVQVHQDTLRTMYFA
Sequence length 857
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Pre-NOTCH Transcription and Translation
MicroRNA (miRNA) biogenesis
Oxidative Stress Induced Senescence
Oncogene Induced Senescence
Ca2+ pathway
Small interfering RNA (siRNA) biogenesis
Post-transcriptional silencing by small RNAs
Transcriptional regulation by small RNAs
TP53 Regulates Metabolic Genes
MAPK6/MAPK4 signaling
Transcriptional Regulation by VENTX
Regulation of RUNX1 Expression and Activity
RUNX1 regulates genes involved in megakaryocyte differentiation and platelet function
Regulation of PTEN mRNA translation
Competing endogenous RNAs (ceRNAs) regulate PTEN translation
Transcriptional Regulation by MECP2
Estrogen-dependent gene expression
NR1H3 & NR1H2 regulate gene expression linked to cholesterol transport and efflux
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Schizophrenia Schizophrenia N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 27669275
Autistic Disorder Associate 34930816
Breast Neoplasms Associate 23696926, 30284063, 32812257
Carcinoma Hepatocellular Associate 21319996, 29487329
Carcinoma Renal Cell Associate 23696926
Cerebral Infarction Associate 32744319
Choroidal Effusions Associate 20716115
Cystic Fibrosis Associate 31664087
Developmental Disabilities Associate 25271087, 34930816
Esophageal Squamous Cell Carcinoma Associate 36990227