Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	26472
Gene name	Protein phosphatase 1 regulatory inhibitor subunit 14B
Gene symbol	PPP1R14B
Synonyms (NCBI Gene)	PHI-1PLCB3NPNGSOM172
Chromosome	11
Chromosome location	11q13.1

Show/Hide all (73)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029319	hsa-miR-26b-5p	Microarray	19088304
MIRT040374	hsa-miR-615-3p	CLASH	23622248
MIRT1255918	hsa-miR-1275	CLIP-seq
MIRT1255919	hsa-miR-1914	CLIP-seq
MIRT1255920	hsa-miR-219-5p	CLIP-seq
MIRT1255921	hsa-miR-2355-3p	CLIP-seq
MIRT1255922	hsa-miR-3163	CLIP-seq
MIRT1255923	hsa-miR-4300	CLIP-seq
MIRT1255924	hsa-miR-4328	CLIP-seq
MIRT1255925	hsa-miR-4477a	CLIP-seq
MIRT1255926	hsa-miR-4648	CLIP-seq
MIRT1255927	hsa-miR-4654	CLIP-seq
MIRT1255928	hsa-miR-4665-5p	CLIP-seq
MIRT1255929	hsa-miR-4769-5p	CLIP-seq
MIRT1255930	hsa-miR-4782-3p	CLIP-seq
MIRT1255931	hsa-miR-486-3p	CLIP-seq
MIRT1255932	hsa-miR-548ac	CLIP-seq
MIRT1255933	hsa-miR-548ae	CLIP-seq
MIRT1255934	hsa-miR-548aj	CLIP-seq
MIRT1255935	hsa-miR-548am	CLIP-seq
MIRT1255936	hsa-miR-548d-3p	CLIP-seq
MIRT1255937	hsa-miR-548x	CLIP-seq
MIRT1255938	hsa-miR-548z	CLIP-seq
MIRT1255939	hsa-miR-676	CLIP-seq
MIRT1255940	hsa-miR-885-3p	CLIP-seq
MIRT1255941	hsa-miR-920	CLIP-seq
MIRT2075438	hsa-miR-3130-3p	CLIP-seq
MIRT1255922	hsa-miR-3163	CLIP-seq
MIRT1255925	hsa-miR-4477a	CLIP-seq
MIRT2075439	hsa-miR-4484	CLIP-seq
MIRT1255931	hsa-miR-486-3p	CLIP-seq
MIRT1255932	hsa-miR-548ac	CLIP-seq
MIRT1255933	hsa-miR-548ae	CLIP-seq
MIRT1255934	hsa-miR-548aj	CLIP-seq
MIRT1255935	hsa-miR-548am	CLIP-seq
MIRT1255936	hsa-miR-548d-3p	CLIP-seq
MIRT1255937	hsa-miR-548x	CLIP-seq
MIRT1255938	hsa-miR-548z	CLIP-seq
MIRT2075440	hsa-miR-767-5p	CLIP-seq
MIRT2302046	hsa-miR-1207-5p	CLIP-seq
MIRT2302047	hsa-miR-183	CLIP-seq
MIRT2302048	hsa-miR-1909	CLIP-seq
MIRT2302049	hsa-miR-3148	CLIP-seq
MIRT1255922	hsa-miR-3163	CLIP-seq
MIRT2302050	hsa-miR-3184	CLIP-seq
MIRT2302051	hsa-miR-331-3p	CLIP-seq
MIRT2302052	hsa-miR-423-5p	CLIP-seq
MIRT2302053	hsa-miR-4271	CLIP-seq
MIRT2302054	hsa-miR-4292	CLIP-seq
MIRT1255924	hsa-miR-4328	CLIP-seq
MIRT1255925	hsa-miR-4477a	CLIP-seq
MIRT2302055	hsa-miR-4640-5p	CLIP-seq
MIRT2302056	hsa-miR-4688	CLIP-seq
MIRT2302057	hsa-miR-4725-3p	CLIP-seq
MIRT2302058	hsa-miR-4726-5p	CLIP-seq
MIRT2302059	hsa-miR-4763-3p	CLIP-seq
MIRT2302060	hsa-miR-4796-3p	CLIP-seq
MIRT1255931	hsa-miR-486-3p	CLIP-seq
MIRT2302061	hsa-miR-548a-3p	CLIP-seq
MIRT1255932	hsa-miR-548ac	CLIP-seq
MIRT1255933	hsa-miR-548ae	CLIP-seq
MIRT1255934	hsa-miR-548aj	CLIP-seq
MIRT1255935	hsa-miR-548am	CLIP-seq
MIRT1255936	hsa-miR-548d-3p	CLIP-seq
MIRT2302062	hsa-miR-548e	CLIP-seq
MIRT2302063	hsa-miR-548f	CLIP-seq
MIRT2302064	hsa-miR-548t	CLIP-seq
MIRT1255937	hsa-miR-548x	CLIP-seq
MIRT1255938	hsa-miR-548z	CLIP-seq
MIRT1255918	hsa-miR-1275	CLIP-seq
MIRT1255928	hsa-miR-4665-5p	CLIP-seq
MIRT1255931	hsa-miR-486-3p	CLIP-seq
MIRT1255940	hsa-miR-885-3p	CLIP-seq

Show/Hide all (7)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004864	Function	Protein phosphatase inhibitor activity	IEA
GO:0004865	Function	Protein serine/threonine phosphatase inhibitor activity	IBA
GO:0005515	Function	Protein binding	IPI	32707033, 33961781
GO:0005737	Component	Cytoplasm	IEA
GO:0019212	Function	Phosphatase inhibitor activity	IEA
GO:0019888	Function	Protein phosphatase regulator activity	IEA
GO:0045087	Process	Innate immune response	IBA

MIM	HGNC	e!Ensembl
601140	9057	ENSG00000173457

Q96C90

Protein name

Protein phosphatase 1 regulatory subunit 14B (Phospholipase C-beta-3 neighbouring gene protein)

Protein function

Inhibitor of PPP1CA. Has over 50-fold higher inhibitory activity when phosphorylated (By similarity).

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF05361	PP1_inhibitor	38 → 147	PKC-activated protein phosphatase-1 inhibitor	Family

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous. Expressed at low levels. {ECO:0000269|PubMed:8838322}.

Sequence

MADSGTAGGAALAAPAPGPGSGGPGPRVYFQSPPGAAGEGPGGADDEGPVRRQGKVTVKY
DRKELRKRLNLEEWILEQLTRLYDCQEEEIPELEIDVDELLDMESDDARAARVKELLVDC
YKPTEAFISGLLDKIRGMQKLSTPQKK

Sequence length

147

Interactions

View interactions

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Familial cancer of breast	Uncertain significance	rs146460382	RCV005939414

Show/Hide Text Mining Associations (8)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Adenocarcinoma of Lung	Associate	40598552
Endometrial Neoplasms	Associate	36824011
Endometriosis	Stimulate	26059197
Neoplasm Metastasis	Stimulate	36484700
Neoplasms	Stimulate	36484700
Neoplasms	Associate	36824011, 38136612
Ovarian Neoplasms	Stimulate	26059197
Triple Negative Breast Neoplasms	Stimulate	36484700

PPP1R14B (protein phosphatase 1 regulatory inhibitor subunit 14B)