Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID	26471
Gene name	Nuclear protein 1, transcriptional regulator
Gene symbol	NUPR1
Synonyms (NCBI Gene)	COM1P8
Chromosome	16
Chromosome location	16p11.2

156

Show/Hide all (156)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018204	hsa-miR-335-5p	Microarray	18185580
MIRT022819	hsa-miR-124-3p	Microarray	18668037
MIRT040412	hsa-miR-615-3p	CLASH	23622248
MIRT755577	hsa-miR-4443	Luciferase reporter assayWestern blottingqRT-PCR	36269411
MIRT1551917	hsa-miR-3160-5p	CLIP-seq
MIRT2057949	hsa-miR-1343	CLIP-seq
MIRT2057950	hsa-miR-3074-5p	CLIP-seq
MIRT2057951	hsa-miR-3124-3p	CLIP-seq
MIRT2057952	hsa-miR-3919	CLIP-seq
MIRT2057953	hsa-miR-3943	CLIP-seq
MIRT2057954	hsa-miR-4315	CLIP-seq
MIRT2057955	hsa-miR-4323	CLIP-seq
MIRT2057956	hsa-miR-4325	CLIP-seq
MIRT2057957	hsa-miR-4749-3p	CLIP-seq
MIRT2057958	hsa-miR-4756-3p	CLIP-seq
MIRT2057959	hsa-miR-483-3p	CLIP-seq
MIRT2286249	hsa-miR-1225-3p	CLIP-seq
MIRT2286250	hsa-miR-1247	CLIP-seq
MIRT2286251	hsa-miR-1275	CLIP-seq
MIRT2057949	hsa-miR-1343	CLIP-seq
MIRT2286252	hsa-miR-136	CLIP-seq
MIRT2286253	hsa-miR-137	CLIP-seq
MIRT2286254	hsa-miR-142-3p	CLIP-seq
MIRT2286255	hsa-miR-149	CLIP-seq
MIRT2286256	hsa-miR-1913	CLIP-seq
MIRT2286257	hsa-miR-296-3p	CLIP-seq
MIRT2057950	hsa-miR-3074-5p	CLIP-seq
MIRT2057951	hsa-miR-3124-3p	CLIP-seq
MIRT2286258	hsa-miR-3137	CLIP-seq
MIRT1551917	hsa-miR-3160-5p	CLIP-seq
MIRT2286259	hsa-miR-3182	CLIP-seq
MIRT2286260	hsa-miR-3194-3p	CLIP-seq
MIRT2286261	hsa-miR-3197	CLIP-seq
MIRT2286262	hsa-miR-324-3p	CLIP-seq
MIRT2286263	hsa-miR-329	CLIP-seq
MIRT2286264	hsa-miR-3612	CLIP-seq
MIRT2286265	hsa-miR-3620	CLIP-seq
MIRT2286266	hsa-miR-362-3p	CLIP-seq
MIRT2286267	hsa-miR-3667-3p	CLIP-seq
MIRT2286268	hsa-miR-3686	CLIP-seq
MIRT2057952	hsa-miR-3919	CLIP-seq
MIRT2057953	hsa-miR-3943	CLIP-seq
MIRT2286269	hsa-miR-4254	CLIP-seq
MIRT2286270	hsa-miR-4264	CLIP-seq
MIRT2286271	hsa-miR-4308	CLIP-seq
MIRT2286272	hsa-miR-4314	CLIP-seq
MIRT2057954	hsa-miR-4315	CLIP-seq
MIRT2057955	hsa-miR-4323	CLIP-seq
MIRT755577	hsa-miR-4443	CLIP-seq
MIRT2286273	hsa-miR-4455	CLIP-seq
MIRT2286274	hsa-miR-4525	CLIP-seq
MIRT2286275	hsa-miR-4527	CLIP-seq
MIRT2286276	hsa-miR-4659a-3p	CLIP-seq
MIRT2286277	hsa-miR-4659b-3p	CLIP-seq
MIRT2286278	hsa-miR-4665-5p	CLIP-seq
MIRT2286279	hsa-miR-4667-5p	CLIP-seq
MIRT2286280	hsa-miR-4691-5p	CLIP-seq
MIRT2286281	hsa-miR-4700-5p	CLIP-seq
MIRT2286282	hsa-miR-4704-3p	CLIP-seq
MIRT2286283	hsa-miR-4715-3p	CLIP-seq
MIRT2286284	hsa-miR-4723-5p	CLIP-seq
MIRT2286285	hsa-miR-4731-5p	CLIP-seq
MIRT2057957	hsa-miR-4749-3p	CLIP-seq
MIRT2057958	hsa-miR-4756-3p	CLIP-seq
MIRT2057959	hsa-miR-483-3p	CLIP-seq
MIRT2286286	hsa-miR-609	CLIP-seq
MIRT2286287	hsa-miR-625	CLIP-seq
MIRT2286288	hsa-miR-637	CLIP-seq
MIRT2286289	hsa-miR-650	CLIP-seq
MIRT2286290	hsa-miR-760	CLIP-seq
MIRT2286291	hsa-miR-765	CLIP-seq
MIRT2057949	hsa-miR-1343	CLIP-seq
MIRT2057955	hsa-miR-4323	CLIP-seq
MIRT2286249	hsa-miR-1225-3p	CLIP-seq
MIRT2286251	hsa-miR-1275	CLIP-seq
MIRT2057949	hsa-miR-1343	CLIP-seq
MIRT2286252	hsa-miR-136	CLIP-seq
MIRT2286255	hsa-miR-149	CLIP-seq
MIRT2286256	hsa-miR-1913	CLIP-seq
MIRT2286257	hsa-miR-296-3p	CLIP-seq
MIRT2057950	hsa-miR-3074-5p	CLIP-seq
MIRT2057951	hsa-miR-3124-3p	CLIP-seq
MIRT2286258	hsa-miR-3137	CLIP-seq
MIRT1551917	hsa-miR-3160-5p	CLIP-seq
MIRT2286259	hsa-miR-3182	CLIP-seq
MIRT2286260	hsa-miR-3194-3p	CLIP-seq
MIRT2286261	hsa-miR-3197	CLIP-seq
MIRT2286262	hsa-miR-324-3p	CLIP-seq
MIRT2286264	hsa-miR-3612	CLIP-seq
MIRT2286265	hsa-miR-3620	CLIP-seq
MIRT2286268	hsa-miR-3686	CLIP-seq
MIRT2057952	hsa-miR-3919	CLIP-seq
MIRT2057953	hsa-miR-3943	CLIP-seq
MIRT2286269	hsa-miR-4254	CLIP-seq
MIRT2286271	hsa-miR-4308	CLIP-seq
MIRT2286272	hsa-miR-4314	CLIP-seq
MIRT2057954	hsa-miR-4315	CLIP-seq
MIRT2057955	hsa-miR-4323	CLIP-seq
MIRT2057956	hsa-miR-4325	CLIP-seq
MIRT755577	hsa-miR-4443	CLIP-seq
MIRT2286274	hsa-miR-4525	CLIP-seq
MIRT2286276	hsa-miR-4659a-3p	CLIP-seq
MIRT2286277	hsa-miR-4659b-3p	CLIP-seq
MIRT2286278	hsa-miR-4665-5p	CLIP-seq
MIRT2286279	hsa-miR-4667-5p	CLIP-seq
MIRT2286281	hsa-miR-4700-5p	CLIP-seq
MIRT2286283	hsa-miR-4715-3p	CLIP-seq
MIRT2286284	hsa-miR-4723-5p	CLIP-seq
MIRT2057957	hsa-miR-4749-3p	CLIP-seq
MIRT2057958	hsa-miR-4756-3p	CLIP-seq
MIRT2057959	hsa-miR-483-3p	CLIP-seq
MIRT2286287	hsa-miR-625	CLIP-seq
MIRT2286288	hsa-miR-637	CLIP-seq
MIRT2286289	hsa-miR-650	CLIP-seq
MIRT2286290	hsa-miR-760	CLIP-seq
MIRT2286291	hsa-miR-765	CLIP-seq
MIRT2286249	hsa-miR-1225-3p	CLIP-seq
MIRT2286251	hsa-miR-1275	CLIP-seq
MIRT2057949	hsa-miR-1343	CLIP-seq
MIRT2286252	hsa-miR-136	CLIP-seq
MIRT2286255	hsa-miR-149	CLIP-seq
MIRT2286256	hsa-miR-1913	CLIP-seq
MIRT2286257	hsa-miR-296-3p	CLIP-seq
MIRT2057950	hsa-miR-3074-5p	CLIP-seq
MIRT2057951	hsa-miR-3124-3p	CLIP-seq
MIRT2286258	hsa-miR-3137	CLIP-seq
MIRT1551917	hsa-miR-3160-5p	CLIP-seq
MIRT2286259	hsa-miR-3182	CLIP-seq
MIRT2286260	hsa-miR-3194-3p	CLIP-seq
MIRT2286261	hsa-miR-3197	CLIP-seq
MIRT2286262	hsa-miR-324-3p	CLIP-seq
MIRT2286264	hsa-miR-3612	CLIP-seq
MIRT2286265	hsa-miR-3620	CLIP-seq
MIRT2286268	hsa-miR-3686	CLIP-seq
MIRT2286269	hsa-miR-4254	CLIP-seq
MIRT2286271	hsa-miR-4308	CLIP-seq
MIRT2286272	hsa-miR-4314	CLIP-seq
MIRT2057954	hsa-miR-4315	CLIP-seq
MIRT2057955	hsa-miR-4323	CLIP-seq
MIRT2057956	hsa-miR-4325	CLIP-seq
MIRT755577	hsa-miR-4443	CLIP-seq
MIRT2286274	hsa-miR-4525	CLIP-seq
MIRT2286276	hsa-miR-4659a-3p	CLIP-seq
MIRT2286277	hsa-miR-4659b-3p	CLIP-seq
MIRT2286278	hsa-miR-4665-5p	CLIP-seq
MIRT2286279	hsa-miR-4667-5p	CLIP-seq
MIRT2286281	hsa-miR-4700-5p	CLIP-seq
MIRT2286283	hsa-miR-4715-3p	CLIP-seq
MIRT2286284	hsa-miR-4723-5p	CLIP-seq
MIRT2057957	hsa-miR-4749-3p	CLIP-seq
MIRT2057959	hsa-miR-483-3p	CLIP-seq
MIRT2286287	hsa-miR-625	CLIP-seq
MIRT2286288	hsa-miR-637	CLIP-seq
MIRT2286289	hsa-miR-650	CLIP-seq
MIRT2286290	hsa-miR-760	CLIP-seq
MIRT2286291	hsa-miR-765	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
ATF4	Activation	19946894

Show/Hide all (67)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002526	Process	Acute inflammatory response	IEA
GO:0003677	Function	DNA binding	EXP	11056169
GO:0003677	Function	DNA binding	IDA	11056169, 18690848
GO:0003677	Function	DNA binding	IEA
GO:0003682	Function	Chromatin binding	IEA
GO:0003713	Function	Transcription coactivator activity	IMP	11940591
GO:0005515	Function	Protein binding	IPI	11940591, 16300740, 16478804, 18690848, 19723804, 20181828, 28720707, 32814053
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	10092851, 16300740
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IDA	16300740
GO:0005737	Component	Cytoplasm	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IBA
GO:0008584	Process	Male gonad development	IEA
GO:0009636	Process	Response to toxic substance	IEA
GO:0010506	Process	Regulation of autophagy	IEA
GO:0010506	Process	Regulation of autophagy	ISS
GO:0010507	Process	Negative regulation of autophagy	IEA
GO:0010507	Process	Negative regulation of autophagy	IMP	20181828
GO:0010507	Process	Negative regulation of autophagy	ISS
GO:0010667	Process	Negative regulation of cardiac muscle cell apoptotic process	IEA
GO:0010667	Process	Negative regulation of cardiac muscle cell apoptotic process	IMP	20181828
GO:0010667	Process	Negative regulation of cardiac muscle cell apoptotic process	ISS
GO:0010698	Function	Acetyltransferase activator activity	IEA
GO:0010698	Function	Acetyltransferase activator activity	ISS
GO:0032993	Component	Protein-DNA complex	IDA	11056169
GO:0035914	Process	Skeletal muscle cell differentiation	IEA
GO:0042771	Process	Intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IMP	16478804, 30451898
GO:0043433	Process	Negative regulation of DNA-binding transcription factor activity	IMP	20181828
GO:0043433	Process	Negative regulation of DNA-binding transcription factor activity	ISS
GO:0043525	Process	Positive regulation of neuron apoptotic process	IEA
GO:0043525	Process	Positive regulation of neuron apoptotic process	ISS
GO:0044346	Process	Fibroblast apoptotic process	IEA
GO:0045171	Component	Intercellular bridge	IDA
GO:0045786	Process	Negative regulation of cell cycle	IBA
GO:0045786	Process	Negative regulation of cell cycle	IEA
GO:0045786	Process	Negative regulation of cell cycle	IMP	19723804
GO:0045787	Process	Positive regulation of cell cycle	IDA	10092851
GO:0045820	Process	Negative regulation of glycolytic process	IMP	30451898
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0048144	Process	Fibroblast proliferation	IEA
GO:0048147	Process	Negative regulation of fibroblast proliferation	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	16300740
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0050680	Process	Negative regulation of epithelial cell proliferation	IEA
GO:0050680	Process	Negative regulation of epithelial cell proliferation	ISS
GO:0062099	Process	Negative regulation of programmed necrotic cell death	IMP	30451898
GO:0065003	Process	Protein-containing complex assembly	IEA
GO:0150078	Process	Positive regulation of neuroinflammatory response	IEA
GO:0150078	Process	Positive regulation of neuroinflammatory response	ISS
GO:1901800	Process	Positive regulation of proteasomal protein catabolic process	IMP	16300740
GO:1902902	Process	Negative regulation of autophagosome assembly	IMP	20181828
GO:1903862	Process	Positive regulation of oxidative phosphorylation	IMP	30451898
GO:1904036	Process	Negative regulation of epithelial cell apoptotic process	IEA
GO:1904036	Process	Negative regulation of epithelial cell apoptotic process	ISS
GO:1904691	Process	Negative regulation of type B pancreatic cell proliferation	IEA
GO:1904691	Process	Negative regulation of type B pancreatic cell proliferation	ISS
GO:1905897	Process	Regulation of response to endoplasmic reticulum stress	IEA
GO:1905897	Process	Regulation of response to endoplasmic reticulum stress	IMP	30451898
GO:1905897	Process	Regulation of response to endoplasmic reticulum stress	ISS
GO:2000194	Process	Regulation of female gonad development	IEA
GO:2000271	Process	Positive regulation of fibroblast apoptotic process	IEA
GO:2001244	Process	Positive regulation of intrinsic apoptotic signaling pathway	IEA
GO:2001244	Process	Positive regulation of intrinsic apoptotic signaling pathway	IMP	27031958
GO:2001244	Process	Positive regulation of intrinsic apoptotic signaling pathway	ISS

MIM	HGNC	e!Ensembl
614812	29990	ENSG00000176046

O60356

Protein name

Nuclear protein 1 (Candidate of metastasis 1) (Protein p8)

Protein function

Transcription regulator that converts stress signals into a program of gene expression that empowers cells with resistance to the stress induced by a change in their microenvironment. Thereby participates in the regulation of many processes name

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF10195	Phospho_p8	21 → 77	DNA-binding nuclear phosphoprotein p8	Family

Tissue specificity

TISSUE SPECIFICITY: Widely expressed, with high levels in liver, pancreas, prostate, ovary, colon, thyroid, spinal cord, trachea and adrenal gland, moderate levels in heart, placenta, lung, skeletal muscle, kidney, testis, small intestine, stomach and lym

Sequence

MATFPPATSAPQQPPGPEDEDSSLDESDLYSLAHSYLGGGGRKGRTKREAAANTNRPSPG
GHERKLVTKLQNSERKKRGARR

Sequence length

Interactions

View interactions

	KEGG
	Transcriptional misregulation in cancer

NUPR1 (nuclear protein 1, transcriptional regulator)