Gene Gene information from NCBI Gene database.
Entrez ID 26469
Gene name Protein tyrosine phosphatase non-receptor type 18
Gene symbol PTPN18
Synonyms (NCBI Gene)
BDP1PTP-HSCF
Chromosome 2
Chromosome location 2q21.1
Summary The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, the mitotic cycle, and oncogenic
miRNA miRNA information provided by mirtarbase database.
357
miRTarBase ID miRNA Experiments Reference
MIRT051290 hsa-miR-16-5p CLASH 23622248
MIRT1275140 hsa-miR-1228 CLIP-seq
MIRT1275141 hsa-miR-1231 CLIP-seq
MIRT1275142 hsa-miR-1257 CLIP-seq
MIRT1275143 hsa-miR-125a-3p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
17
GO ID Ontology Definition Evidence Reference
GO:0001825 Process Blastocyst formation IEA
GO:0004721 Function Phosphoprotein phosphatase activity IEA
GO:0004725 Function Protein tyrosine phosphatase activity EXP 25081058
GO:0004725 Function Protein tyrosine phosphatase activity IBA
GO:0004725 Function Protein tyrosine phosphatase activity IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
606587 9649 ENSG00000072135
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q99952
Protein name Tyrosine-protein phosphatase non-receptor type 18 (EC 3.1.3.48) (Brain-derived phosphatase)
Protein function Differentially dephosphorylate autophosphorylated tyrosine kinases which are known to be overexpressed in tumor tissues.
PDB 2OC3 , 4GFU , 4GFV , 4NND
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00102 Y_phosphatase 56 290 Protein-tyrosine phosphatase Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in brain, colon and several tumor-derived cell lines. {ECO:0000269|PubMed:8950995}.
Sequence
MSRSLDSARSFLERLEARGGREGAVLAGEFSDIQACSAAWKADGVCSTVAGSRPENVRKN
RYKDVLPYDQTRVILSLLQEEGHSDYINGNFIRGVDGSLAYIATQGPLPHTLLDFWRLVW
EFGVKVILMACREIENGRKRCERYWAQEQEPLQTGLFCITLIKEKWLNEDIMLRTLKVTF
QKESRSVYQLQYMSWPDRGVPSSPDHMLAMVEEARRLQGSGPEPLCVHCSAGCGRTGVLC
TVDYVRQLLLTQMIPPDFSLFDVVLKMRKQRPAAVQTEEQYRFLYHTVAQ
MFCSTLQNAS
PHYQNIKENCAPLYDDALFLRTPQALLAIPRPPGGVLRSISVPGSPGHAMADTYAVVQKR
GAPAGAGSGTQTGTGTGTGARSAEEAPLYSKVTPRAQRPGAHAEDARGTLPGRVPADQSP
AGSGAYEDVAGGAQTGGLGFNLRIGRPKGPRDPPAEWTRV
Sequence length 460
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Downregulation of ERBB2 signaling
Interleukin-37 signaling
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
LIVER CIRRHOSIS, EXPERIMENTAL CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References Evidence Score
Breast Neoplasms Associate 25081058
★☆☆☆☆
Found in Text Mining only
Breast Neoplasms Inhibit 35982039
★☆☆☆☆
Found in Text Mining only
Carcinoma Hepatocellular Associate 29742497
★☆☆☆☆
Found in Text Mining only
Cleft Palate Associate 32241273
★☆☆☆☆
Found in Text Mining only
Gastrointestinal Stromal Tumors Associate 25349971, 30149002
★☆☆☆☆
Found in Text Mining only
Myelodysplastic Syndromes Associate 32027948
★☆☆☆☆
Found in Text Mining only
Neoplasm Metastasis Inhibit 35982039
★☆☆☆☆
Found in Text Mining only