Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	26468
Gene name Gene Name - the full gene name approved by the HGNC.	LIM homeobox 6
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	LHX6
Synonyms (NCBI Gene) Gene synonyms aliases	LHX6.1, hLHX6
Chromosome Chromosome number	9
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	9q33.2
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of a large protein family that contains the LIM domain, a unique cysteine-rich zinc-binding domain. The encoded protein has tandem LIM domains as well as a DNA-binding homeodomain. The protein functions as a transcription factor

Show/Hide all(46)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016904	hsa-miR-335-5p	Microarray	18185580
MIRT028799	hsa-miR-26b-5p	Microarray	19088304
MIRT572716	hsa-miR-218-2-3p	PAR-CLIP	20371350
MIRT572715	hsa-miR-892c-5p	PAR-CLIP	20371350
MIRT572714	hsa-miR-506-5p	PAR-CLIP	20371350
MIRT572712	hsa-miR-3919	PAR-CLIP	20371350
MIRT572713	hsa-miR-4756-3p	PAR-CLIP	20371350
MIRT572711	hsa-miR-5690	PAR-CLIP	20371350
MIRT572710	hsa-miR-1273f	PAR-CLIP	20371350
MIRT572709	hsa-miR-8069	PAR-CLIP	20371350
MIRT572708	hsa-miR-218-1-3p	PAR-CLIP	20371350
MIRT572716	hsa-miR-218-2-3p	PAR-CLIP	20371350
MIRT572715	hsa-miR-892c-5p	PAR-CLIP	20371350
MIRT572714	hsa-miR-506-5p	PAR-CLIP	20371350
MIRT572712	hsa-miR-3919	PAR-CLIP	20371350
MIRT572713	hsa-miR-4756-3p	PAR-CLIP	20371350
MIRT572711	hsa-miR-5690	PAR-CLIP	20371350
MIRT572710	hsa-miR-1273f	PAR-CLIP	20371350
MIRT572709	hsa-miR-8069	PAR-CLIP	20371350
MIRT572708	hsa-miR-218-1-3p	PAR-CLIP	20371350
MIRT755546	hsa-miR-1290	Luciferase reporter assay, Western blotting, qRT-PCR	34729246
MIRT1109045	hsa-miR-1245b-5p	CLIP-seq
MIRT1109046	hsa-miR-1266	CLIP-seq
MIRT1109047	hsa-miR-1285	CLIP-seq
MIRT1109048	hsa-miR-1295	CLIP-seq
MIRT1109049	hsa-miR-1913	CLIP-seq
MIRT1109050	hsa-miR-3142	CLIP-seq
MIRT1109051	hsa-miR-3157-3p	CLIP-seq
MIRT1109052	hsa-miR-3187-5p	CLIP-seq
MIRT1109053	hsa-miR-324-3p	CLIP-seq
MIRT1109054	hsa-miR-3664-3p	CLIP-seq
MIRT1109055	hsa-miR-4492	CLIP-seq
MIRT1109056	hsa-miR-4498	CLIP-seq
MIRT1109057	hsa-miR-4505	CLIP-seq
MIRT1109058	hsa-miR-4518	CLIP-seq
MIRT1109059	hsa-miR-4757-5p	CLIP-seq
MIRT1109060	hsa-miR-612	CLIP-seq
MIRT1109061	hsa-miR-762	CLIP-seq
MIRT2030144	hsa-miR-1293	CLIP-seq
MIRT2030145	hsa-miR-3682-3p	CLIP-seq
MIRT2030146	hsa-miR-4483	CLIP-seq
MIRT2261028	hsa-miR-330-3p	CLIP-seq
MIRT2261029	hsa-miR-380	CLIP-seq
MIRT2261030	hsa-miR-4495	CLIP-seq
MIRT2261031	hsa-miR-488	CLIP-seq
MIRT2261032	hsa-miR-548m	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
PITX2	Activation	23229549

Show/Hide all(17)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0003700	Function	DNA-binding transcription factor activity	NAS	10393337
GO:0005515	Function	Protein binding	IPI	25416956, 32296183, 32814053
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005634	Component	Nucleus	IDA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA	21873635
GO:0021799	Process	Cerebral cortex radially oriented cell migration	ISS
GO:0021800	Process	Cerebral cortex tangential migration	ISS
GO:0021853	Process	Cerebral cortex GABAergic interneuron migration	ISS
GO:0021884	Process	Forebrain neuron development	IBA	21873635
GO:0030182	Process	Neuron differentiation	IBA	21873635
GO:0046872	Function	Metal ion binding	IEA
GO:0048469	Process	Cell maturation	ISS
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

MIM	HGNC	e!Ensembl
608215	21735	ENSG00000106852

Protein

UniProt ID

Q9UPM6

Protein name

LIM/homeobox protein Lhx6 (LIM homeobox protein 6) (LIM/homeobox protein Lhx6.1)

Protein function

Probable transcription factor required for the expression of a subset of genes involved in interneurons migration and development. Functions in the specification of cortical interneuron subtypes and in the migration of GABAergic interneuron prec

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00412	LIM	70 → 127	LIM domain	Domain
PF00412	LIM	131 → 188	LIM domain	Domain
PF00046	Homeodomain	220 → 276	Homeodomain	Domain

Sequence

MAQPGSGCKATTRCLEGTAPPAMAQSDAEALAGALDKDEGQASPCTPSTPSVCSPPSAAS
SVPSAGKNICSSCGLEILDRYLLKVNNLIWHVRCLECSVCRTSLRQQNSCYIKNKEIFCK
MDYFSRFGTKCARCGRQIYASDWVRRARGNAYHLACFACFSCKRQLSTGEEFGLVEEKVL
CRIHYDTMIENLKRAAENGNGLTLEGAVPSEQDSQPKPAKRARTSFTAEQLQVMQAQFAQ
DNNPDAQTLQKLADMTGLSRRVIQVWFQNCRARHKKHTPQHPVPPSGAPPSRLPSALSDD
IHYTPFSSPERARMVTLHGYIESQVQCGQVHCRLPYTAPPVHLKADMDGPLSNRGEKVIL
FQY

Sequence length

363

Interactions

View interactions

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Schizophrenia	Schizophrenia	rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346 View all (12 more)	22937123, 22983435

Show/Hide Text Mining Associations (14)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma of Lung	Associate	27610375
Anodontia	Associate	23549991
Asthma	Associate	30669148
Breast Neoplasms	Inhibit	29863252
Carcinogenesis	Associate	29863252, 33977077
Glioblastoma	Associate	38563293
Glioma	Associate	32857719
Hypoxia	Inhibit	38563293
Hypoxia Brain	Associate	31562861
Macular Degeneration	Associate	35240203
Neoplasms	Associate	29863252
Neoplasms	Inhibit	35384355
Schizophrenia	Associate	27328999
Uterine Cervical Neoplasms	Associate	30389505, 35384355

LHX6 (LIM homeobox 6)