Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
26354
Gene name Gene Name - the full gene name approved by the HGNC.
G protein nucleolar 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
GNL3
Synonyms (NCBI Gene) Gene synonyms aliases
C77032, E2IG3, NNP47, NS, Nug1
Chromosome Chromosome number
3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
3p21.1
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene may interact with p53 and may be involved in tumorigenesis. The encoded protein also appears to be important for stem cell proliferation. This protein is found in both the nucleus and nucleolus. Three transcript variants e
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT029281 hsa-miR-26b-5p Microarray 19088304
MIRT047156 hsa-miR-183-5p CLASH 23622248
MIRT039623 hsa-miR-615-3p CLASH 23622248
MIRT039623 hsa-miR-615-3p CLASH 23622248
MIRT237525 hsa-miR-495-5p PAR-CLIP 20371350
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0003723 Function RNA binding HDA 22658674, 22681889
GO:0005515 Function Protein binding IPI 16097049, 17932509, 19487455, 21132010, 21988832, 22641345, 24550003, 24965446, 26638075, 32296183
GO:0005525 Function GTP binding ISS
GO:0005615 Component Extracellular space HDA 22664934
GO:0005634 Component Nucleus ISS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
608011 29931 ENSG00000163938
Protein
UniProt ID Q9BVP2
Protein name Guanine nucleotide-binding protein-like 3 (E2-induced gene 3 protein) (Novel nucleolar protein 47) (NNP47) (Nucleolar GTP-binding protein 3) (Nucleostemin)
Protein function May be required to maintain the proliferative capacity of stem cells. Stabilizes MDM2 by preventing its ubiquitination, and hence proteasomal degradation (By similarity).
PDB 8FKP , 8FKR , 8FKT , 8FKU , 8FKV , 8FKW , 8FKX , 8FKY , 8FKZ , 8FL0 , 8FL2 , 8FL3 , 8FL4 , 8INK , 8IPD , 8IPX , 8IPY , 8IR1 , 8IR3 , 8RL2
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF08701 GN3L_Grn1 16 89 GNL3L/Grn1 putative GTPase Family
PF01926 MMR_HSR1 256 367 50S ribosome-binding GTPase Family
Tissue specificity TISSUE SPECIFICITY: Increased levels in lung tissue in cancer patients. {ECO:0000269|PubMed:16012751}.
Sequence
MKRPKLKKASKRMTCHKRYKIQKKVREHHRKLRKEAKKRGHKKPRKDPGVPNSAPFKEAL
LREAELRKQRLEELKQQQKLDRQKELEKK
RKLETNPDIKPSNVEPMEKEFGLCKTENKAK
SGKQNSKKLYCQELKKVIEASDVVLEVLDARDPLGCRCPQVEEAIVQSGQKKLVLILNKS
DLVPKENLESWLNYLKKELPTVVFRASTKPKDKGKITKRVKAKKNAAPFRSEVCFGKEGL
WKLLGGFQETCSKAIRVGVIGFPNVGKSSIINSLKQEQMCNVGVSMGLTRSMQVVPLDKQ
ITIIDSPSFIVSPLNSSSALALRSPASIEVVKPMEAASAILSQADARQVVLKYTVPGYRN
SLEFFTV
LAQRRGMHQKGGIPNVEGAAKLLWSEWTGASLAYYCHPPTSWTPPPYFNESIV
VDMKSGFNLEELEKNNAQSIRAIKGPHLANSILFQSSGLTNGIIEEKDIHEELPKRKERK
QEEREDDKDSDQETVDEEVDENSSGMFAAEETGEALSEETTAGEQSTRSFILDKIIEEDD
AYDFSTDYV
Sequence length 549
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Ribosome biogenesis in eukaryotes   Major pathway of rRNA processing in the nucleolus and cytosol
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Arthritis Degenerative polyarthritis rs1594890601, rs1594882933, rs184370809, rs776489319, rs1594883470 22763110
Unknown
Disease term Disease name Evidence References Source
Mental depression Major Depressive Disorder 22472876 ClinVar
Associations from Text Mining
Disease Name Relationship Type References
Bipolar Disorder Associate 29947131
Breast Neoplasms Associate 24610951, 24650343, 24716972, 30817632
Carcinogenesis Associate 16670719, 18419830, 26722529
Carcinoma Hepatocellular Associate 26517370, 32051231
Carcinoma Squamous Cell Associate 17970071
Colorectal Neoplasms Associate 24762489
Colorectal Neoplasms Stimulate 28849076
Disease Associate 19318567
Esophageal Neoplasms Associate 22050045
Head and Neck Neoplasms Associate 17970071