Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	26330
Gene name Gene Name - the full gene name approved by the HGNC.	Glyceraldehyde-3-phosphate dehydrogenase, spermatogenic
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	GAPDHS
Synonyms (NCBI Gene) Gene synonyms aliases	GAPD2, GAPDH-2, GAPDS, HEL-S-278, HSD-35
Chromosome Chromosome number	19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	19q13.12
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a protein belonging to the glyceraldehyde-3-phosphate dehydrogenase family of enzymes that play an important role in carbohydrate metabolism. Like its somatic cell counterpart, this sperm-specific enzyme functions in a nicotinamide adeni

Show/Hide all(3)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018010	hsa-miR-335-5p	Microarray	18185580
MIRT1999819	hsa-miR-3667-3p	CLIP-seq
MIRT1999820	hsa-miR-4691-5p	CLIP-seq

Show/Hide all(17)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004365	Function	Glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity	IBA
GO:0004365	Function	Glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity	IEA
GO:0004365	Function	Glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity	TAS	10714828
GO:0005515	Function	Protein binding	IPI	16820410, 28514442, 32296183, 33961781
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	TAS
GO:0006006	Process	Glucose metabolic process	IEA
GO:0006096	Process	Glycolytic process	IBA
GO:0006096	Process	Glycolytic process	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0016620	Function	Oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor	IEA
GO:0030317	Process	Flagellated sperm motility	ISS
GO:0045821	Process	Positive regulation of glycolytic process	TAS	10714828
GO:0050661	Function	NADP binding	IEA
GO:0051287	Function	NAD binding	IEA

MIM	HGNC	e!Ensembl
609169	24864	ENSG00000105679

Protein

UniProt ID

O14556

Protein name

Glyceraldehyde-3-phosphate dehydrogenase, testis-specific (EC 1.2.1.12) (Spermatogenic cell-specific glyceraldehyde 3-phosphate dehydrogenase 2) (GAPDH-2) (Spermatogenic glyceraldehyde-3-phosphate dehydrogenase)

Protein function

May play an important role in regulating the switch between different pathways for energy production during spermiogenesis and in the spermatozoon. Required for sperm motility and male fertility (By similarity).

PDB

3H9E , 3PFW , 5C7L , 5C7O

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00044	Gp_dh_N	76 → 176	Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain	Domain
PF02800	Gp_dh_C	229 → 386	Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Testis specific.

Sequence

MSKRDIVLTNVTVVQLLRQPCPVTRAPPPPEPKAEVEPQPQPEPTPVREEIKPPPPPLPP
HPATPPPKMVSVARELTVGINGFGRIGRLVLRACMEKGVKVVAVNDPFIDPEYMVYMFKY
DSTHGRYKGSVEFRNGQLVVDNHEISVYQCKEPKQIPWRAVGSPYVVESTGVYLSIQAAS
DHISAGAQRVVISAPSPDAPMFVMGVNENDYNPGSMNIVSNASCTTNCLAPLAKVIHERF
GIVEGLMTTVHSYTATQKTVDGPSRKAWRDGRGAHQNIIPASTGAAKAVTKVIPELKGKL
TGMAFRVPTPDVSVVDLTCRLAQPAPYSAIKEAVKAAAKGPMAGILAYTEDEVVSTDFLG
DTHSSIFDAKAGIALNDNFVKLISWYDNEYGYSHRVVDLLRYMFSRDK

Sequence length

408

Interactions

View interactions

	KEGG		Reactome
	Glycolysis / Gluconeogenesis Metabolic pathways		Glycolysis Gluconeogenesis

GAPDHS (glyceraldehyde-3-phosphate dehydrogenase, spermatogenic)