FGF21 (fibroblast growth factor 21)

Gene
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
26291
Gene name Gene Name - the full gene name approved by the HGNC.
Fibroblast growth factor 21
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
FGF21
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
19q13.33
Summary Summary of gene provided in NCBI Entrez Gene.
Theis gene encodes a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities and are involved in a variety of biological processes. This protein is a secreted endocrine factor that funct
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(7)
miRTarBase ID miRNA Experiments Reference
MIRT731299 hsa-miR-149-5p Western blot 27061435
MIRT731299 hsa-miR-149-5p Western blot 27061435
MIRT755574 hsa-miR-143-3p Luciferase reporter assay 36602629
MIRT995644 hsa-miR-1276 CLIP-seq
MIRT995645 hsa-miR-4311 CLIP-seq
Transcription factors
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(1)
Transcription factor Regulation Reference
ATF4 Activation 22233381
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(33)
GO ID Ontology Definition Evidence Reference
GO:0001934 Process Positive regulation of protein phosphorylation IBA 21873635
GO:0005104 Function Fibroblast growth factor receptor binding IBA 21873635
GO:0005515 Function Protein binding IPI 18829467, 19059246, 19117008, 32296183, 32814053
GO:0005576 Component Extracellular region TAS 10858549
GO:0005615 Component Extracellular space IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
609436 3678 ENSG00000105550
Protein
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Q9NSA1
Protein name Fibroblast growth factor 21 (FGF-21)
Protein function Stimulates glucose uptake in differentiated adipocytes via the induction of glucose transporter SLC2A1/GLUT1 expression (but not SLC2A4/GLUT4 expression). Activity requires the presence of KLB. Regulates systemic glucose homeostasis and insulin
PDB 5VAQ , 6M6E , 6M6F
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00167 FGF 45 → 155 Fibroblast growth factor Domain
Sequence 
MDSDETGFEHSGLWVSVLAGLLLGACQAHPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAH
LEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEA
CSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGI
LAPQPPDVGSSDPLSMVGPSQGRSPSYAS
Sequence length 209
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
Calcium signaling pathway
PI3K-Akt signaling pathway
Thermogenesis
Regulation of actin cytoskeleton
Pathways in cancer
Melanoma
Breast cancer
Gastric cancer 		  Cellular hexose transport
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (2)
Causal
Disease term Disease name dbSNP ID References
Diabetes mellitus Diabetes Mellitus, Insulin-Dependent, Diabetes Mellitus, Non-Insulin-Dependent, Diabetes Mellitus, Ketosis-Prone, Diabetes Mellitus, Sudden-Onset rs587776515, rs61730328, rs606231121, rs606231122, rs79020217, rs77625743, rs78378398, rs606231123, rs1362648752, rs104893649, rs80356624, rs80356616, rs80356625, rs80356611, rs104894237
View all (293 more)		 23499715, 26797127
Obesity Obesity rs74315349, rs1474810899, rs121918111, rs796065034, rs753856820, rs796065035, rs121918112, rs104894023, rs137852821, rs1580764441, rs137852822, rs137852823, rs137852824, rs13447324, rs121913562
View all (27 more)		 26797127, 24184811
Show/Hide Unknown Diseases (3)
Unknown
Disease term Disease name Evidence References Source
Gout Gout GWAS
Alzheimer disease Alzheimer disease GWAS
Diabetes Diabetes GWAS
Show/Hide Text Mining Associations (117)
Associations from Text Mining
Disease Name Relationship Type References
Acute Kidney Injury Associate 31205953
Acute Lung Injury Inhibit 37864659
Alzheimer Disease Inhibit 33131010
Alzheimer Disease Associate 33946944
Angina Unstable Stimulate 30185439
Arthritis Rheumatoid Stimulate 22881230
Asthma Associate 30892731
Atherosclerosis Inhibit 29367522
Atherosclerosis Associate 30185439, 32431189
Atrial Fibrillation Associate 26823820, 29351855