Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	26289
Gene name Gene Name - the full gene name approved by the HGNC.	Adenylate kinase 5
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	AK5
Synonyms (NCBI Gene) Gene synonyms aliases	AK6
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1p31.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the adenylate kinase family, which is involved in regulating the adenine nucleotide composition within a cell by catalyzing the reversible transfer of phosphate groups among adenine nucleotides. This member is related to the

Show/Hide all(41)

miRTarBase ID	miRNA	Experiments
MIRT775146	hsa-miR-1273g	CLIP-seq
MIRT775147	hsa-miR-2114	CLIP-seq
MIRT775148	hsa-miR-323-5p	CLIP-seq
MIRT775149	hsa-miR-3689d	CLIP-seq
MIRT775150	hsa-miR-3911	CLIP-seq
MIRT775151	hsa-miR-4266	CLIP-seq
MIRT775152	hsa-miR-4434	CLIP-seq
MIRT775153	hsa-miR-4447	CLIP-seq
MIRT775154	hsa-miR-4472	CLIP-seq
MIRT775155	hsa-miR-4488	CLIP-seq
MIRT775156	hsa-miR-4516	CLIP-seq
MIRT775157	hsa-miR-4531	CLIP-seq
MIRT775158	hsa-miR-4695-5p	CLIP-seq
MIRT775159	hsa-miR-4697-5p	CLIP-seq
MIRT775160	hsa-miR-4779	CLIP-seq
MIRT775161	hsa-miR-541	CLIP-seq
MIRT775162	hsa-miR-651	CLIP-seq
MIRT775163	hsa-miR-654-5p	CLIP-seq
MIRT775164	hsa-miR-876-3p	CLIP-seq
MIRT775165	hsa-miR-144	CLIP-seq
MIRT775166	hsa-miR-3123	CLIP-seq
MIRT775167	hsa-miR-329	CLIP-seq
MIRT775168	hsa-miR-362-3p	CLIP-seq
MIRT775169	hsa-miR-3691-3p	CLIP-seq
MIRT775170	hsa-miR-3925-5p	CLIP-seq
MIRT775171	hsa-miR-3976	CLIP-seq
MIRT775172	hsa-miR-4645-3p	CLIP-seq
MIRT775173	hsa-miR-4662a-5p	CLIP-seq
MIRT775174	hsa-miR-495	CLIP-seq
MIRT2443428	hsa-miR-1231	CLIP-seq
MIRT2443429	hsa-miR-3616-5p	CLIP-seq
MIRT2443430	hsa-miR-3647-5p	CLIP-seq
MIRT775150	hsa-miR-3911	CLIP-seq
MIRT2443431	hsa-miR-4288	CLIP-seq
MIRT775152	hsa-miR-4434	CLIP-seq
MIRT775156	hsa-miR-4516	CLIP-seq
MIRT775157	hsa-miR-4531	CLIP-seq
MIRT2443432	hsa-miR-4795-5p	CLIP-seq
MIRT2443433	hsa-miR-573	CLIP-seq
MIRT2443434	hsa-miR-595	CLIP-seq
MIRT2443435	hsa-miR-632	CLIP-seq

Show/Hide all(19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004017	Function	Adenylate kinase activity	IEA
GO:0004550	Function	Nucleoside diphosphate kinase activity	IBA	21873635
GO:0004550	Function	Nucleoside diphosphate kinase activity	IDA	23416111
GO:0005524	Function	ATP binding	IEA
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005829	Component	Cytosol	IBA	21873635
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0006165	Process	Nucleoside diphosphate phosphorylation	IBA	21873635
GO:0006165	Process	Nucleoside diphosphate phosphorylation	IDA	23416111
GO:0006172	Process	ADP biosynthetic process	TAS	10215863
GO:0006173	Process	DADP biosynthetic process	TAS	10215863
GO:0009142	Process	Nucleoside triphosphate biosynthetic process	IBA	21873635
GO:0009142	Process	Nucleoside triphosphate biosynthetic process	IDA	23416111
GO:0009220	Process	Pyrimidine ribonucleotide biosynthetic process	TAS	10215863
GO:0015949	Process	Nucleobase-containing small molecule interconversion	TAS
GO:0034451	Component	Centriolar satellite	IDA
GO:0046034	Process	ATP metabolic process	IEA
GO:0046940	Process	Nucleoside monophosphate phosphorylation	IEA

MIM	HGNC	e!Ensembl
608009	365	ENSG00000154027

Protein

UniProt ID

Q9Y6K8

Protein name

Adenylate kinase isoenzyme 5 (AK 5) (EC 2.7.4.3) (EC 2.7.4.6) (ATP-AMP transphosphorylase 5)

Protein function

Nucleoside monophosphate (NMP) kinase that catalyzes the reversible transfer of the terminal phosphate group between nucleoside triphosphates and monophosphates. Active on AMP and dAMP with ATP as a donor. When GTP is used as phosphate donor, th

PDB

2BWJ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00406	ADK	137 → 294		Domain
PF00406	ADK	381 → 537		Domain

Tissue specificity

TISSUE SPECIFICITY: Brain specific. {ECO:0000269|PubMed:10215863}.

Sequence

MNTNDAKEYLARREIPQLFESLLNGLMCSKPEDPVEYLESCLQKVKELGGCDKVKWDTFV
SQEKKTLPPLNGGQSRRSFLRNVMPENSNFPYRRYDRLPPIHQFSIESDTDLSETAELIE
EYEVFDPTRPRPKIILVIGGPGSGKGTQSLKIAERYGFQYISVGELLRKKIHSTSSNRKW
SLIAKIITTGELAPQETTITEIKQKLMQIPDEEGIVIDGFPRDVAQALSFEDQICTPDLV
VFLACANQRLKERLLKRAEQQGRPDDNVKATQRRLMNFKQNAAPLVKYFQEKGLIMTFDA
DRDEDEVFYDISMAVDNKLFPNKEAAAGSSDLDPSMILDTGEIIDTGSDYEDQGDDQLNV
FGEDTMGGFMEDLRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLSTGELLREELASESE
RSKLIRDIMERGDLVPSGIVLELLKEAMVASLGDTRGFLIDGYPREVKQGEEFGRRIGDP
QLVICMDCSADTMTNRLLQRSRSSLPVDDTTKTIAKRLEAYYRASIPVIAYYETKTQLHK
INAEGTPEDVFLQLCTAIDSIF

Sequence length

562

Interactions

View interactions

	KEGG		Reactome
	Purine metabolism Thiamine metabolism Metabolic pathways Nucleotide metabolism Biosynthesis of cofactors		Interconversion of nucleotide di- and triphosphates

Show/Hide Causal Diseases (4)

Disease term	Disease name	dbSNP ID	References
Causal
Lung adenocarcinoma	Adenocarcinoma of lung (disorder)	rs28934576, rs121913530, rs397516975, rs587776805, rs121913469, rs121913364, rs121913351, rs121913366, rs397516896, rs397516977, rs397516981, rs397517127, rs121913344, rs727504233, rs121913370 View all (5 more)	28604730
Lung carcinoma	Carcinoma of lung	rs1805076, rs121909071, rs121913530, rs112445441, rs121913529, rs121913535, rs121913297, rs121913279, rs104886003, rs397516975, rs11554290, rs121913364, rs121913351, rs121913369, rs121913355 View all (44 more)	28604730
Multiple sclerosis	Multiple Sclerosis	rs104895219, rs483353022, rs483353023, rs483353028, rs483353029, rs483353024, rs483353030, rs3207617, rs483353031, rs483353032, rs483353033, rs483353034, rs483353035, rs483353036, rs483353039 View all (4 more)	17660530
Narcolepsy	Narcolepsy	rs104894574, rs387906655	19629137

Show/Hide Unknown Diseases (3)

Disease term	Disease name	Source
Unknown
Diabetes	Diabetes	GWAS
Bipolar Disorder	Bipolar Disorder	GWAS
Metabolic Syndrome	Metabolic Syndrome	GWAS

Show/Hide Text Mining Associations (17)

Disease Name	Relationship Type	References
Associations from Text Mining
Alzheimer Disease	Associate	25311278
Amnesia	Associate	33843981
Anorexia	Stimulate	33843981
Celiac Disease	Associate	28505210
Colonic Neoplasms	Associate	34135408
Colorectal Neoplasms	Associate	34135408
Depressive Disorder	Associate	33843981
Encephalitis	Associate	33843981
Glioma	Associate	40715243
Heart Failure	Associate	31059043
Hyperglycemia	Inhibit	21556322
Limbic Encephalitis	Associate	33843981
Neoplasm Metastasis	Associate	34135408
Neoplasms	Associate	31799658
Seizures	Associate	33843981
Stomach Neoplasms	Associate	31799658
Weight Loss	Associate	33843981

AK5 (adenylate kinase 5)