Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	26272
Gene name Gene Name - the full gene name approved by the HGNC.	F-box protein 4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	FBXO4
Synonyms (NCBI Gene) Gene synonyms aliases	FBX4
Chromosome Chromosome number	5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	5p13.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box

Show/Hide all(25)

miRTarBase ID	miRNA	Experiments	Reference
MIRT024311	hsa-miR-215-5p	Microarray	19074876
MIRT026787	hsa-miR-192-5p	Microarray	19074876
MIRT992455	hsa-miR-105	CLIP-seq
MIRT992456	hsa-miR-1276	CLIP-seq
MIRT992457	hsa-miR-2054	CLIP-seq
MIRT992458	hsa-miR-23a	CLIP-seq
MIRT992459	hsa-miR-23b	CLIP-seq
MIRT992460	hsa-miR-23c	CLIP-seq
MIRT992461	hsa-miR-3671	CLIP-seq
MIRT992462	hsa-miR-4311	CLIP-seq
MIRT992463	hsa-miR-4738-3p	CLIP-seq
MIRT992464	hsa-miR-499-3p	CLIP-seq
MIRT992465	hsa-miR-499a-3p	CLIP-seq
MIRT992466	hsa-miR-513a-3p	CLIP-seq
MIRT992467	hsa-miR-522	CLIP-seq
MIRT992468	hsa-miR-578	CLIP-seq
MIRT992469	hsa-miR-583	CLIP-seq
MIRT992470	hsa-miR-584	CLIP-seq
MIRT992471	hsa-miR-607	CLIP-seq
MIRT992472	hsa-miR-643	CLIP-seq
MIRT1994344	hsa-miR-3156-5p	CLIP-seq
MIRT1994345	hsa-miR-4277	CLIP-seq
MIRT2228375	hsa-miR-3646	CLIP-seq
MIRT2449555	hsa-miR-3200-3p	CLIP-seq
MIRT2449556	hsa-miR-3924	CLIP-seq

Show/Hide all(29)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000151	Component	Ubiquitin ligase complex	IDA	10531035
GO:0000209	Process	Protein polyubiquitination	IDA	20181953
GO:0000209	Process	Protein polyubiquitination	TAS
GO:0004842	Function	Ubiquitin-protein transferase activity	IDA	10531035
GO:0005515	Function	Protein binding	IPI	16278047, 19487455, 20159592, 20181953, 21242966, 23108047, 24389012, 27705803, 28514442, 32296183, 32814053
GO:0005737	Component	Cytoplasm	IDA	21378169
GO:0005829	Component	Cytosol	TAS
GO:0007568	Process	Aging	IEA
GO:0010608	Process	Posttranscriptional regulation of gene expression	IEA
GO:0016567	Process	Protein ubiquitination	IDA	10531035, 16275645
GO:0016567	Process	Protein ubiquitination	TAS	24389012
GO:0019005	Component	SCF ubiquitin ligase complex	IDA	20181953
GO:0019725	Process	Cellular homeostasis	IEA
GO:0031146	Process	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	IDA	20159592
GO:0031398	Process	Positive regulation of protein ubiquitination	IDA	24389012
GO:0031647	Process	Regulation of protein stability	IDA	24389012
GO:0031647	Process	Regulation of protein stability	IMP	16275645
GO:0031648	Process	Protein destabilization	IEA
GO:0032212	Process	Positive regulation of telomere maintenance via telomerase	IC	24389012
GO:0032212	Process	Positive regulation of telomere maintenance via telomerase	IMP	16275645
GO:0035726	Process	Common myeloid progenitor cell proliferation	IEA
GO:0042803	Function	Protein homodimerization activity	IPI	20181953
GO:0043687	Process	Post-translational protein modification	TAS
GO:0048147	Process	Negative regulation of fibroblast proliferation	IEA
GO:0061630	Function	Ubiquitin protein ligase activity	IEA
GO:0071479	Process	Cellular response to ionizing radiation	IEA
GO:1900181	Process	Negative regulation of protein localization to nucleus	IEA
GO:1902916	Process	Positive regulation of protein polyubiquitination	IEA
GO:2000001	Process	Regulation of DNA damage checkpoint	IEA

MIM	HGNC	e!Ensembl
609090	13583	ENSG00000151876

Protein

UniProt ID

Q9UKT5

Protein name

F-box only protein 4

Protein function

Substrate recognition component of a SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex that mediates the ubiquitination and subsequent proteasomal degradation of target proteins (PubMed:10531035, PubMed:18598945, PubMed:20181953,

PDB

3L2O , 3L82 , 9JKB

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00646	F-box	57 → 104	F-box domain	Domain

Sequence

MAGSEPRSGTNSPPPPFSDWGRLEAAILSGWKTFWQSVSKERVARTTSREEVDEAASTLT
RLPIDVQLYILSFLSPHDLCQLGSTNHYWNETVRDPILWRYFLLRDLPSWSSVDWKSLPD
LEILKKPISEVTDGAFFDYMAVYRMCCPYTRRASKSSRPMYGAVTSFLHSLIIQNEPRFA
MFGPGLEELNTSLVLSLMSSEELCPTAGLPQRQIDGIGSGVNFQLNNQHKFNILILYSTT
RKERDRAREEHTSAVNKMFSRHNEGDDQQGSRYSVIPQIQKVCEVVDGFIYVANAEAHKR
HEWQDEFSHIMAMTDPAFGSSGRPLLVLSCISQGDVKRMPCFYLAHELHLNLLNHPWLVQ
DTEAETLTGFLNGIEWILEEVESKRAR

Sequence length

387

Interactions

View interactions

	KEGG		Reactome
	Ubiquitin mediated proteolysis		Neddylation Antigen processing: Ubiquitination & Proteasome degradation

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Esophagus neoplasm	Malignant neoplasm of esophagus	rs28934578, rs121918714, rs1567556006, rs1575166666

Show/Hide Text Mining Associations (6)

Disease Name	Relationship Type	References
Associations from Text Mining
Carcinogenesis	Associate	33784509, 36329064
Esophageal Neoplasms	Associate	33784509
Esophageal Squamous Cell Carcinoma	Associate	33784509
Neoplasm Metastasis	Inhibit	36329064
Neoplasms	Associate	36329064
Sleep Apnea Obstructive	Associate	35132330

FBXO4 (F-box protein 4)