FBXO4 (F-box protein 4)

Gene

• Entrez ID: 26272
• Gene name: F-box protein 4
• Gene symbol: FBXO4
• Synonyms (NCBI Gene): FBX4
• Chromosome: 5
• Chromosome location: 5p13.1
• Summary: This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT024311	hsa-miR-215-5p	Microarray	19074876
MIRT026787	hsa-miR-192-5p	Microarray	19074876
MIRT992455	hsa-miR-105	CLIP-seq
MIRT992456	hsa-miR-1276	CLIP-seq
MIRT992457	hsa-miR-2054	CLIP-seq
MIRT992458	hsa-miR-23a	CLIP-seq
MIRT992459	hsa-miR-23b	CLIP-seq
MIRT992460	hsa-miR-23c	CLIP-seq
MIRT992461	hsa-miR-3671	CLIP-seq
MIRT992462	hsa-miR-4311	CLIP-seq
MIRT992463	hsa-miR-4738-3p	CLIP-seq
MIRT992464	hsa-miR-499-3p	CLIP-seq
MIRT992465	hsa-miR-499a-3p	CLIP-seq
MIRT992466	hsa-miR-513a-3p	CLIP-seq
MIRT992467	hsa-miR-522	CLIP-seq
MIRT992468	hsa-miR-578	CLIP-seq
MIRT992469	hsa-miR-583	CLIP-seq
MIRT992470	hsa-miR-584	CLIP-seq
MIRT992471	hsa-miR-607	CLIP-seq
MIRT992472	hsa-miR-643	CLIP-seq
MIRT1994344	hsa-miR-3156-5p	CLIP-seq
MIRT1994345	hsa-miR-4277	CLIP-seq
MIRT2228375	hsa-miR-3646	CLIP-seq
MIRT2449555	hsa-miR-3200-3p	CLIP-seq
MIRT2449556	hsa-miR-3924	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000151	Component	Ubiquitin ligase complex	IDA	10531035
GO:0000209	Process	Protein polyubiquitination	IBA
GO:0000209	Process	Protein polyubiquitination	IDA	16275645, 20181953
GO:0000723	Process	Telomere maintenance	IMP	16275645
GO:0002183	Process	Cytoplasmic translational initiation	IDA	34731628
GO:0004842	Function	Ubiquitin-protein transferase activity	IDA	10531035
GO:0004842	Function	Ubiquitin-protein transferase activity	IEA
GO:0005515	Function	Protein binding	IPI	16275645, 16278047, 19487455, 20159592, 20181953, 21242966, 23108047, 24389012, 27705803, 28514442, 32296183, 32814053, 33961781
GO:0005737	Component	Cytoplasm	IDA	21378169
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IDA	16275645
GO:0010556	Process	Regulation of macromolecule biosynthetic process	IEA
GO:0010608	Process	Post-transcriptional regulation of gene expression	IEA
GO:0016567	Process	Protein ubiquitination	IDA	10531035, 16275645
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016567	Process	Protein ubiquitination	TAS	24389012
GO:0019005	Component	SCF ubiquitin ligase complex	IBA
GO:0019005	Component	SCF ubiquitin ligase complex	IDA	20181953
GO:0019005	Component	SCF ubiquitin ligase complex	IEA
GO:0019725	Process	Cellular homeostasis	IEA
GO:0031146	Process	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	IBA
GO:0031146	Process	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	IDA	20159592, 29142209
GO:0031146	Process	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	IEA
GO:0031398	Process	Positive regulation of protein ubiquitination	IDA	16275645, 24389012
GO:0031398	Process	Positive regulation of protein ubiquitination	IEA
GO:0031647	Process	Regulation of protein stability	IDA	24389012
GO:0031647	Process	Regulation of protein stability	IEA
GO:0031647	Process	Regulation of protein stability	IMP	16275645
GO:0031648	Process	Protein destabilization	IEA
GO:0032212	Process	Positive regulation of telomere maintenance via telomerase	IC	24389012
GO:0032212	Process	Positive regulation of telomere maintenance via telomerase	IMP	16275645
GO:0035726	Process	Common myeloid progenitor cell proliferation	IEA
GO:0042803	Function	Protein homodimerization activity	IPI	20181953
GO:0045727	Process	Positive regulation of translation	IDA	34731628
GO:0048147	Process	Negative regulation of fibroblast proliferation	IEA
GO:0061630	Function	Ubiquitin protein ligase activity	IEA
GO:0071479	Process	Cellular response to ionizing radiation	IEA
GO:0090398	Process	Cellular senescence	IEA
GO:0140694	Process	Membraneless organelle assembly	ISS	35951695
GO:1900181	Process	Negative regulation of protein localization to nucleus	IEA
GO:1902916	Process	Positive regulation of protein polyubiquitination	IEA
GO:1990756	Function	Ubiquitin-like ligase-substrate adaptor activity	IDA	29142209
GO:1990756	Function	Ubiquitin-like ligase-substrate adaptor activity	IEA
GO:2000001	Process	Regulation of DNA damage checkpoint	IEA

Other IDs

• MIM: 609090
• HGNC: 13583
• e!Ensembl: ENSG00000151876

Protein

• UniProt ID: Q9UKT5
• Protein name: F-box only protein 4
• Protein function: Substrate recognition component of a SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex that mediates the ubiquitination and subsequent proteasomal degradation of target proteins (PubMed:10531035, PubMed:18598945, PubMed:20181953,
• PDB: 3L2O, 3L82, 9JKB
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00646	F-box	57 → 104	F-box domain	Domain

• Sequence:

  MAGSEPRSGTNSPPPPFSDWGRLEAAILSGWKTFWQSVSKERVARTTSREEVDEAASTLT
  RLPIDVQLYILSFLSPHDLCQLGSTNHYWNETVRDPILWRYFLLRDLPSWSSVDWKSLPD
  LEILKKPISEVTDGAFFDYMAVYRMCCPYTRRASKSSRPMYGAVTSFLHSLIIQNEPRFA
  MFGPGLEELNTSLVLSLMSSEELCPTAGLPQRQIDGIGSGVNFQLNNQHKFNILILYSTT
  RKERDRAREEHTSAVNKMFSRHNEGDDQQGSRYSVIPQIQKVCEVVDGFIYVANAEAHKR
  HEWQDEFSHIMAMTDPAFGSSGRPLLVLSCISQGDVKRMPCFYLAHELHLNLLNHPWLVQ
  DTEAETLTGFLNGIEWILEEVESKRAR

• Sequence length: 387

Pathways

KEGG:

Ubiquitin mediated proteolysis

Reactome:

Neddylation
Antigen processing: Ubiquitination & Proteasome degradation