Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	26270
Gene name	F-box protein 6
Gene symbol	FBXO6
Synonyms (NCBI Gene)	FBG2FBS2FBX6Fbx6b
Chromosome	1
Chromosome location	1p36.22
Summary	This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box

182

Show/Hide all (182)

miRTarBase ID	miRNA	Experiments	Reference
MIRT509014	hsa-miR-4438	PAR-CLIP	23446348
MIRT509013	hsa-miR-449b-3p	PAR-CLIP	23446348
MIRT509012	hsa-miR-371b-3p	PAR-CLIP	23446348
MIRT509011	hsa-miR-128-3p	PAR-CLIP	23446348
MIRT509010	hsa-miR-216a-3p	PAR-CLIP	23446348
MIRT509009	hsa-miR-3681-3p	PAR-CLIP	23446348
MIRT509008	hsa-miR-1234-3p	PAR-CLIP	23446348
MIRT509007	hsa-miR-7107-5p	PAR-CLIP	23446348
MIRT509006	hsa-miR-5095	PAR-CLIP	23446348
MIRT509005	hsa-miR-7151-3p	PAR-CLIP	23446348
MIRT509004	hsa-miR-6807-5p	PAR-CLIP	23446348
MIRT735264	hsa-miR-133a-5p	Luciferase reporter assayWestern blottingqRT-PCR	34249610
MIRT509014	hsa-miR-4438	PAR-CLIP	23446348
MIRT509013	hsa-miR-449b-3p	PAR-CLIP	23446348
MIRT509012	hsa-miR-371b-3p	PAR-CLIP	23446348
MIRT509011	hsa-miR-128-3p	PAR-CLIP	23446348
MIRT509010	hsa-miR-216a-3p	PAR-CLIP	23446348
MIRT509009	hsa-miR-3681-3p	PAR-CLIP	23446348
MIRT509008	hsa-miR-1234-3p	PAR-CLIP	23446348
MIRT509007	hsa-miR-7107-5p	PAR-CLIP	23446348
MIRT509006	hsa-miR-5095	PAR-CLIP	23446348
MIRT509005	hsa-miR-7151-3p	PAR-CLIP	23446348
MIRT509004	hsa-miR-6807-5p	PAR-CLIP	23446348
MIRT992913	hsa-miR-1193	CLIP-seq
MIRT992914	hsa-miR-122	CLIP-seq
MIRT992915	hsa-miR-1234	CLIP-seq
MIRT992916	hsa-miR-128	CLIP-seq
MIRT992917	hsa-miR-129-5p	CLIP-seq
MIRT992918	hsa-miR-1307	CLIP-seq
MIRT992919	hsa-miR-1912	CLIP-seq
MIRT992920	hsa-miR-1976	CLIP-seq
MIRT992921	hsa-miR-2276	CLIP-seq
MIRT992922	hsa-miR-2392	CLIP-seq
MIRT992923	hsa-miR-3149	CLIP-seq
MIRT992924	hsa-miR-3187-3p	CLIP-seq
MIRT992925	hsa-miR-3194-3p	CLIP-seq
MIRT992926	hsa-miR-3199	CLIP-seq
MIRT992927	hsa-miR-411	CLIP-seq
MIRT992928	hsa-miR-4258	CLIP-seq
MIRT992929	hsa-miR-4284	CLIP-seq
MIRT992930	hsa-miR-4297	CLIP-seq
MIRT992931	hsa-miR-4435	CLIP-seq
MIRT992932	hsa-miR-4497	CLIP-seq
MIRT992933	hsa-miR-4520a-3p	CLIP-seq
MIRT992934	hsa-miR-4659a-3p	CLIP-seq
MIRT992935	hsa-miR-4659b-3p	CLIP-seq
MIRT992936	hsa-miR-4701-5p	CLIP-seq
MIRT992937	hsa-miR-4707-3p	CLIP-seq
MIRT992938	hsa-miR-4711-5p	CLIP-seq
MIRT992939	hsa-miR-4735-5p	CLIP-seq
MIRT992940	hsa-miR-4740-3p	CLIP-seq
MIRT992941	hsa-miR-4775	CLIP-seq
MIRT992942	hsa-miR-5096	CLIP-seq
MIRT992943	hsa-miR-548s	CLIP-seq
MIRT992944	hsa-miR-556-5p	CLIP-seq
MIRT992945	hsa-miR-570	CLIP-seq
MIRT992946	hsa-miR-588	CLIP-seq
MIRT992947	hsa-miR-590-3p	CLIP-seq
MIRT992948	hsa-miR-640	CLIP-seq
MIRT992949	hsa-miR-720	CLIP-seq
MIRT992913	hsa-miR-1193	CLIP-seq
MIRT992914	hsa-miR-122	CLIP-seq
MIRT992917	hsa-miR-129-5p	CLIP-seq
MIRT992918	hsa-miR-1307	CLIP-seq
MIRT992922	hsa-miR-2392	CLIP-seq
MIRT992923	hsa-miR-3149	CLIP-seq
MIRT992924	hsa-miR-3187-3p	CLIP-seq
MIRT992926	hsa-miR-3199	CLIP-seq
MIRT992927	hsa-miR-411	CLIP-seq
MIRT992928	hsa-miR-4258	CLIP-seq
MIRT992931	hsa-miR-4435	CLIP-seq
MIRT992936	hsa-miR-4701-5p	CLIP-seq
MIRT992937	hsa-miR-4707-3p	CLIP-seq
MIRT992938	hsa-miR-4711-5p	CLIP-seq
MIRT992939	hsa-miR-4735-5p	CLIP-seq
MIRT992940	hsa-miR-4740-3p	CLIP-seq
MIRT992941	hsa-miR-4775	CLIP-seq
MIRT992942	hsa-miR-5096	CLIP-seq
MIRT992943	hsa-miR-548s	CLIP-seq
MIRT992946	hsa-miR-588	CLIP-seq
MIRT992947	hsa-miR-590-3p	CLIP-seq
MIRT992949	hsa-miR-720	CLIP-seq
MIRT2228470	hsa-miR-106a	CLIP-seq
MIRT2228471	hsa-miR-106b	CLIP-seq
MIRT992914	hsa-miR-122	CLIP-seq
MIRT992916	hsa-miR-128	CLIP-seq
MIRT992918	hsa-miR-1307	CLIP-seq
MIRT2228472	hsa-miR-150	CLIP-seq
MIRT2228473	hsa-miR-17	CLIP-seq
MIRT992920	hsa-miR-1976	CLIP-seq
MIRT2228474	hsa-miR-20a	CLIP-seq
MIRT2228475	hsa-miR-20b	CLIP-seq
MIRT992921	hsa-miR-2276	CLIP-seq
MIRT2228476	hsa-miR-302a	CLIP-seq
MIRT2228477	hsa-miR-302b	CLIP-seq
MIRT2228478	hsa-miR-302c	CLIP-seq
MIRT2228479	hsa-miR-302d	CLIP-seq
MIRT2228480	hsa-miR-302e	CLIP-seq
MIRT992925	hsa-miR-3194-3p	CLIP-seq
MIRT992926	hsa-miR-3199	CLIP-seq
MIRT2228481	hsa-miR-372	CLIP-seq
MIRT2228482	hsa-miR-373	CLIP-seq
MIRT992928	hsa-miR-4258	CLIP-seq
MIRT992929	hsa-miR-4284	CLIP-seq
MIRT992930	hsa-miR-4297	CLIP-seq
MIRT992932	hsa-miR-4497	CLIP-seq
MIRT992937	hsa-miR-4707-3p	CLIP-seq
MIRT2228483	hsa-miR-4713-5p	CLIP-seq
MIRT2228484	hsa-miR-4731-5p	CLIP-seq
MIRT992939	hsa-miR-4735-5p	CLIP-seq
MIRT992940	hsa-miR-4740-3p	CLIP-seq
MIRT992941	hsa-miR-4775	CLIP-seq
MIRT2228485	hsa-miR-512-3p	CLIP-seq
MIRT2228486	hsa-miR-519d	CLIP-seq
MIRT2228487	hsa-miR-520a-3p	CLIP-seq
MIRT2228488	hsa-miR-520b	CLIP-seq
MIRT2228489	hsa-miR-520c-3p	CLIP-seq
MIRT2228490	hsa-miR-520d-3p	CLIP-seq
MIRT2228491	hsa-miR-520e	CLIP-seq
MIRT2228492	hsa-miR-520g	CLIP-seq
MIRT2228493	hsa-miR-520h	CLIP-seq
MIRT2228494	hsa-miR-532-3p	CLIP-seq
MIRT992947	hsa-miR-590-3p	CLIP-seq
MIRT992948	hsa-miR-640	CLIP-seq
MIRT992949	hsa-miR-720	CLIP-seq
MIRT2228495	hsa-miR-93	CLIP-seq
MIRT992944	hsa-miR-556-5p	CLIP-seq
MIRT992949	hsa-miR-720	CLIP-seq
MIRT992914	hsa-miR-122	CLIP-seq
MIRT992917	hsa-miR-129-5p	CLIP-seq
MIRT992923	hsa-miR-3149	CLIP-seq
MIRT992926	hsa-miR-3199	CLIP-seq
MIRT992927	hsa-miR-411	CLIP-seq
MIRT992928	hsa-miR-4258	CLIP-seq
MIRT992937	hsa-miR-4707-3p	CLIP-seq
MIRT992939	hsa-miR-4735-5p	CLIP-seq
MIRT992941	hsa-miR-4775	CLIP-seq
MIRT992947	hsa-miR-590-3p	CLIP-seq
MIRT992917	hsa-miR-129-5p	CLIP-seq
MIRT992923	hsa-miR-3149	CLIP-seq
MIRT992927	hsa-miR-411	CLIP-seq
MIRT992939	hsa-miR-4735-5p	CLIP-seq
MIRT992941	hsa-miR-4775	CLIP-seq
MIRT992947	hsa-miR-590-3p	CLIP-seq
MIRT992914	hsa-miR-122	CLIP-seq
MIRT992917	hsa-miR-129-5p	CLIP-seq
MIRT992918	hsa-miR-1307	CLIP-seq
MIRT992921	hsa-miR-2276	CLIP-seq
MIRT992923	hsa-miR-3149	CLIP-seq
MIRT992925	hsa-miR-3194-3p	CLIP-seq
MIRT992926	hsa-miR-3199	CLIP-seq
MIRT992927	hsa-miR-411	CLIP-seq
MIRT992928	hsa-miR-4258	CLIP-seq
MIRT992929	hsa-miR-4284	CLIP-seq
MIRT992930	hsa-miR-4297	CLIP-seq
MIRT992932	hsa-miR-4497	CLIP-seq
MIRT992937	hsa-miR-4707-3p	CLIP-seq
MIRT992938	hsa-miR-4711-5p	CLIP-seq
MIRT992939	hsa-miR-4735-5p	CLIP-seq
MIRT992940	hsa-miR-4740-3p	CLIP-seq
MIRT992941	hsa-miR-4775	CLIP-seq
MIRT992942	hsa-miR-5096	CLIP-seq
MIRT992947	hsa-miR-590-3p	CLIP-seq
MIRT992949	hsa-miR-720	CLIP-seq
MIRT992914	hsa-miR-122	CLIP-seq
MIRT992917	hsa-miR-129-5p	CLIP-seq
MIRT992918	hsa-miR-1307	CLIP-seq
MIRT992921	hsa-miR-2276	CLIP-seq
MIRT992923	hsa-miR-3149	CLIP-seq
MIRT992925	hsa-miR-3194-3p	CLIP-seq
MIRT992926	hsa-miR-3199	CLIP-seq
MIRT992927	hsa-miR-411	CLIP-seq
MIRT992928	hsa-miR-4258	CLIP-seq
MIRT992929	hsa-miR-4284	CLIP-seq
MIRT992930	hsa-miR-4297	CLIP-seq
MIRT992932	hsa-miR-4497	CLIP-seq
MIRT992937	hsa-miR-4707-3p	CLIP-seq
MIRT992939	hsa-miR-4735-5p	CLIP-seq
MIRT992941	hsa-miR-4775	CLIP-seq
MIRT992942	hsa-miR-5096	CLIP-seq
MIRT992947	hsa-miR-590-3p	CLIP-seq
MIRT992949	hsa-miR-720	CLIP-seq

Show/Hide all (30)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000077	Process	DNA damage checkpoint signaling	TAS	19716789
GO:0005515	Function	Protein binding	IPI	19716789, 23108047, 27705803, 28514442, 30833792, 32296183, 33961781
GO:0005515	Function	Protein binding	ISS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	19716789
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006281	Process	DNA repair	IEA
GO:0006281	Process	DNA repair	TAS	19716789
GO:0006508	Process	Proteolysis	TAS	10531035
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IEA
GO:0006516	Process	Glycoprotein catabolic process	IBA
GO:0006516	Process	Glycoprotein catabolic process	IEA
GO:0006974	Process	DNA damage response	IEA
GO:0006986	Process	Response to unfolded protein	IEA
GO:0016567	Process	Protein ubiquitination	IEA
GO:0019005	Component	SCF ubiquitin ligase complex	IBA
GO:0019005	Component	SCF ubiquitin ligase complex	IDA	19716789
GO:0019005	Component	SCF ubiquitin ligase complex	IEA
GO:0030246	Function	Carbohydrate binding	IEA
GO:0031146	Process	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	IBA
GO:0031146	Process	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	IDA	19716789
GO:0031146	Process	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	IEA
GO:0036503	Process	ERAD pathway	IBA
GO:0036503	Process	ERAD pathway	IEA
GO:0036503	Process	ERAD pathway	ISS
GO:0044322	Component	Endoplasmic reticulum quality control compartment	IBA
GO:0044322	Component	Endoplasmic reticulum quality control compartment	IEA
GO:0061630	Function	Ubiquitin protein ligase activity	IBA
GO:0061630	Function	Ubiquitin protein ligase activity	IEA

MIM	HGNC	e!Ensembl
605647	13585	ENSG00000116663

Q9NRD1

Protein name

F-box only protein 6 (F-box protein that recognizes sugar chains 2) (F-box/G-domain protein 2)

Protein function

Substrate-recognition component of some SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complexes. Involved in endoplasmic reticulum-associated degradation pathway (ERAD) for misfolded lumenal proteins by recognizing and binding sugar cha

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF12937	F-box-like	13 → 60	F-box-like	Domain
PF04300	FBA	79 → 257	F-box associated region	Family

Sequence

MDAPHSKAALDSINELPENILLELFTHVPARQLLLNCRLVCSLWRDLIDLMTLWKRKCLR
EGFITKDWDQPVADWKIFYFLRSLHRNLLRNPCAEEDMFAWQIDFNGGDRWKVESLPGAH
GTDFPDPKVKKYFVTSYEMCLKSQLVDLVAEGYWEELLDTFRPDIVVKDWFAARADCGCT
YQLKVQLASADYFVLASFEPPPVTIQQWNNATWTEVSYTFSDYPRGVRYILFQHGGRDTQ
YWAGWYGPRVTNSSIVVSPKMTRNQASSEAQPGQKHGQEEAAQSPYRAVVQIF

Sequence length

293

Interactions

View interactions

	KEGG		Reactome
	Protein processing in endoplasmic reticulum		Neddylation Antigen processing: Ubiquitination & Proteasome degradation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
STEVENS-JOHNSON SYNDROME	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (9)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Asthma	Associate	29956778	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Associate	19716789	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Non Small Cell Lung	Associate	31140586, 37694353	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	19716789	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Associate	37353812	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Associate	28341977	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Associate	19515249, 31140586	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Associate	34930465	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Associate	35043518	★★★★★ ★☆☆☆☆ Found in Text Mining only

FBXO6 (F-box protein 6)