FBXO8 (F-box protein 8)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID 26269
Gene name F-box protein 8
Gene symbol FBXO8
Synonyms (NCBI Gene)
DC10FBSFBX8
Chromosome 4
Chromosome location 4q34.1
Summary This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box
miRNA miRNA information provided by mirtarbase database.
50
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (50)
miRTarBase ID miRNA Experiments Reference
MIRT019812 hsa-miR-375 Microarray 20215506
MIRT031200 hsa-miR-19b-3p Sequencing 20371350
MIRT031200 hsa-miR-19b-3p PAR-CLIP 21572407
MIRT557911 hsa-miR-19a-3p PAR-CLIP 21572407
MIRT557910 hsa-miR-424-3p PAR-CLIP 21572407
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
8
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (8)
GO ID Ontology Definition Evidence Reference
GO:0000151 Component Ubiquitin ligase complex IEA
GO:0000151 Component Ubiquitin ligase complex NAS 10945468
GO:0005085 Function Guanyl-nucleotide exchange factor activity IBA
GO:0005085 Function Guanyl-nucleotide exchange factor activity IEA
GO:0005515 Function Protein binding IPI 31024008
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
605649 13587 ENSG00000164117
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9NRD0
Protein name F-box only protein 8 (F-box/SEC7 protein FBS)
Protein function May promote guanine-nucleotide exchange on an ARF. Promotes the activation of ARF through replacement of GDP with GTP (Potential).
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01369 Sec7 136 → 313 Sec7 domain Domain
Sequence 
MGQGLWRVVRNQQLQQEGYSEQGYLTREQSRRMAASNISNTNHRKQVQGGIDIYHLLKAR
KSKEQEGFINLEMLPPELSFTILSYLNATDLCLASCVWQDLANDELLWQGLCKSTWGHCS
IYNKNPPLGFSFRKLYMQLDEGSLTFNANPDEGVNYFMSKGILDDSPKEIAKFIFCTRTL
NWKKLRIYLDERRDVLDDLVTLHNFRNQFLPNALREFFRHIHAPEERGEYLETLITKFSH
RFCACNPDLMRELGLSPDAVYVLCYSLILLSIDLTSPHVKNKMSKREFIRNTRRAAQNIS
EDFVGHLYDNIYLIGHVAA
Sequence length 319
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
10
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (9)
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Cervical cancer Benign rs61748174 RCV005913081
Clear cell carcinoma of kidney Benign rs61748174, rs115274413 RCV005913082
RCV005912056
Colon adenocarcinoma Benign rs61748174 RCV005913079
Familial cancer of breast Benign rs61748174 RCV005913078
Show/Hide Text Mining Associations (7)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Diabetes Mellitus Type 1 Associate 34659254
Glioma Inhibit 25550853
Inflammation Associate 34659254
Leukemia Associate 24741612
Leukemia Myeloid Acute Associate 24741612
Neoplasm Metastasis Associate 25550853
Neoplasms Associate 25550853