FBXO8 (F-box protein 8)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
26269
Gene name Gene Name - the full gene name approved by the HGNC.
F-box protein 8
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
FBXO8
Synonyms (NCBI Gene) Gene synonyms aliases
DC10, FBS, FBX8
Disease Acronyms (UniProt) Disease acronyms from UniProt database
FBS
Chromosome Chromosome number
4
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
4q34.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(50)
miRTarBase ID miRNA Experiments Reference
MIRT019812 hsa-miR-375 Microarray 20215506
MIRT031200 hsa-miR-19b-3p Sequencing 20371350
MIRT031200 hsa-miR-19b-3p PAR-CLIP 21572407
MIRT557911 hsa-miR-19a-3p PAR-CLIP 21572407
MIRT557910 hsa-miR-424-3p PAR-CLIP 21572407
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(5)
GO ID Ontology Definition Evidence Reference
GO:0000151 Component Ubiquitin ligase complex NAS 10945468
GO:0005085 Function Guanyl-nucleotide exchange factor activity IEA
GO:0006511 Process Ubiquitin-dependent protein catabolic process NAS 10945468
GO:0032012 Process Regulation of ARF protein signal transduction IEA
GO:0050790 Process Regulation of catalytic activity IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
605649 13587 ENSG00000164117
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Q9NRD0
Protein name F-box only protein 8 (F-box/SEC7 protein FBS)
Protein function May promote guanine-nucleotide exchange on an ARF. Promotes the activation of ARF through replacement of GDP with GTP (Potential).
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01369 Sec7 136 → 313 Sec7 domain Domain
Sequence 
MGQGLWRVVRNQQLQQEGYSEQGYLTREQSRRMAASNISNTNHRKQVQGGIDIYHLLKAR
KSKEQEGFINLEMLPPELSFTILSYLNATDLCLASCVWQDLANDELLWQGLCKSTWGHCS
IYNKNPPLGFSFRKLYMQLDEGSLTFNANPDEGVNYFMSKGILDDSPKEIAKFIFCTRTL
NWKKLRIYLDERRDVLDDLVTLHNFRNQFLPNALREFFRHIHAPEERGEYLETLITKFSH
RFCACNPDLMRELGLSPDAVYVLCYSLILLSIDLTSPHVKNKMSKREFIRNTRRAAQNIS
EDFVGHLYDNIYLIGHVAA
Sequence length 319
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Breast cancer Malignant neoplasm of breast rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158
View all (309 more)
Show/Hide Text Mining Associations (7)
Associations from Text Mining
Disease Name Relationship Type References
Diabetes Mellitus Type 1 Associate 34659254
Glioma Inhibit 25550853
Inflammation Associate 34659254
Leukemia Associate 24741612
Leukemia Myeloid Acute Associate 24741612
Neoplasm Metastasis Associate 25550853
Neoplasms Associate 25550853