Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	2625
Gene name	GATA binding protein 3
Gene symbol	GATA3
Synonyms (NCBI Gene)	HDRHDRS
Chromosome	10
Chromosome location	10p14
Summary	This gene encodes a protein which belongs to the GATA family of transcription factors. The protein contains two GATA-type zinc fingers and is an important regulator of T-cell development and plays an important role in endothelial cell biology. Defects in

Show/Hide all (13)

SNP ID	Visualize variation	Clinical significance	Consequence
rs104894162	C>T	Pathogenic	Stop gained, coding sequence variant
rs104894163	T>A	Pathogenic	Missense variant, coding sequence variant
rs104894164	C>T	Pathogenic	Stop gained, coding sequence variant
rs104894165	A>G,T	Pathogenic	Missense variant, coding sequence variant, synonymous variant
rs112417755	G>C,T	Pathogenic	Splice acceptor variant
rs387906551	T>GCTTACTTCCC	Pathogenic	Splice donor variant
rs387906621	G>A	Pathogenic	Coding sequence variant, missense variant
rs767074039	T>C,G	Likely-pathogenic	Coding sequence variant, missense variant
rs1085307641	AT>-	Likely-pathogenic	Frameshift variant, coding sequence variant
rs1564405153	A>-,AA	Likely-pathogenic, uncertain-significance	Frameshift variant, coding sequence variant
rs1564405163	G>A,C	Likely-pathogenic, uncertain-significance	Missense variant, coding sequence variant
rs1588383622	G>A	Pathogenic	Missense variant, coding sequence variant
rs1588391546	->AAAAAGTGCA	Likely-pathogenic	Frameshift variant, coding sequence variant

522

Show/Hide all (522)

miRTarBase ID	miRNA	Experiments	Reference
MIRT021783	hsa-miR-132-3p	Microarray	17612493
MIRT024016	hsa-miR-1-3p	Microarray	18668037
MIRT049754	hsa-miR-92a-3p	CLASH	23622248
MIRT438911	hsa-miR-29b-3p	Luciferase reporter assayqRT-PCR	23354167
MIRT438911	hsa-miR-29b-3p	Luciferase reporter assayqRT-PCR	23354167
MIRT057215	hsa-miR-10b-5p	3'LIFE	25074381
MIRT057215	hsa-miR-10b-5p	3'LIFE	25074381
MIRT731292	hsa-miR-27a-3p	Luciferase reporter assay	26834155
MIRT731292	hsa-miR-27a-3p	Luciferase reporter assay	26834155
MIRT731292	hsa-miR-27a-3p	Luciferase reporter assay	26834155
MIRT737216	hsa-miR-455-3p	Luciferase reporter assayImmunoprecipitaion (IP)qRT-PCR	31492753
MIRT1012506	hsa-miR-101	CLIP-seq
MIRT1012507	hsa-miR-10a	CLIP-seq
MIRT1012508	hsa-miR-10b	CLIP-seq
MIRT1012509	hsa-miR-1204	CLIP-seq
MIRT1012510	hsa-miR-1245	CLIP-seq
MIRT1012511	hsa-miR-1245b-5p	CLIP-seq
MIRT1012512	hsa-miR-1252	CLIP-seq
MIRT1012513	hsa-miR-1272	CLIP-seq
MIRT1012514	hsa-miR-1273g	CLIP-seq
MIRT1012515	hsa-miR-128	CLIP-seq
MIRT1012516	hsa-miR-1286	CLIP-seq
MIRT1012517	hsa-miR-1295	CLIP-seq
MIRT1012518	hsa-miR-1322	CLIP-seq
MIRT1012519	hsa-miR-1323	CLIP-seq
MIRT1012520	hsa-miR-135a	CLIP-seq
MIRT1012521	hsa-miR-135b	CLIP-seq
MIRT1012522	hsa-miR-140-3p	CLIP-seq
MIRT1012523	hsa-miR-140-5p	CLIP-seq
MIRT1012524	hsa-miR-141	CLIP-seq
MIRT1012525	hsa-miR-142-5p	CLIP-seq
MIRT1012526	hsa-miR-144	CLIP-seq
MIRT1012527	hsa-miR-1470	CLIP-seq
MIRT1012528	hsa-miR-150	CLIP-seq
MIRT1012529	hsa-miR-155	CLIP-seq
MIRT1012530	hsa-miR-1827	CLIP-seq
MIRT1012531	hsa-miR-1912	CLIP-seq
MIRT1012532	hsa-miR-198	CLIP-seq
MIRT1012533	hsa-miR-200a	CLIP-seq
MIRT1012534	hsa-miR-205	CLIP-seq
MIRT1012535	hsa-miR-208a	CLIP-seq
MIRT1012536	hsa-miR-208b	CLIP-seq
MIRT1012537	hsa-miR-2116	CLIP-seq
MIRT1012538	hsa-miR-2355-3p	CLIP-seq
MIRT1012539	hsa-miR-2467-3p	CLIP-seq
MIRT1012540	hsa-miR-2682	CLIP-seq
MIRT1012541	hsa-miR-27a	CLIP-seq
MIRT1012542	hsa-miR-27b	CLIP-seq
MIRT1012543	hsa-miR-300	CLIP-seq
MIRT1012544	hsa-miR-3074-3p	CLIP-seq
MIRT1012545	hsa-miR-3121-3p	CLIP-seq
MIRT1012546	hsa-miR-3121-5p	CLIP-seq
MIRT1012547	hsa-miR-3130-5p	CLIP-seq
MIRT1012548	hsa-miR-3142	CLIP-seq
MIRT1012549	hsa-miR-3148	CLIP-seq
MIRT1012550	hsa-miR-3160-5p	CLIP-seq
MIRT1012551	hsa-miR-3201	CLIP-seq
MIRT1012552	hsa-miR-330-3p	CLIP-seq
MIRT1012553	hsa-miR-338-5p	CLIP-seq
MIRT1012554	hsa-miR-34a	CLIP-seq
MIRT1012555	hsa-miR-34c-3p	CLIP-seq
MIRT1012556	hsa-miR-34c-5p	CLIP-seq
MIRT1012557	hsa-miR-3613-3p	CLIP-seq
MIRT1012558	hsa-miR-361-5p	CLIP-seq
MIRT1012559	hsa-miR-3670	CLIP-seq
MIRT1012560	hsa-miR-3678-3p	CLIP-seq
MIRT1012561	hsa-miR-3688-3p	CLIP-seq
MIRT1012562	hsa-miR-3688-5p	CLIP-seq
MIRT1012563	hsa-miR-3692	CLIP-seq
MIRT1012564	hsa-miR-369-3p	CLIP-seq
MIRT1012565	hsa-miR-3714	CLIP-seq
MIRT1012566	hsa-miR-374a	CLIP-seq
MIRT1012567	hsa-miR-374b	CLIP-seq
MIRT1012568	hsa-miR-380	CLIP-seq
MIRT1012569	hsa-miR-381	CLIP-seq
MIRT1012570	hsa-miR-3907	CLIP-seq
MIRT1012571	hsa-miR-3921	CLIP-seq
MIRT1012572	hsa-miR-4261	CLIP-seq
MIRT1012573	hsa-miR-4272	CLIP-seq
MIRT1012574	hsa-miR-4274	CLIP-seq
MIRT1012575	hsa-miR-4275	CLIP-seq
MIRT1012576	hsa-miR-4276	CLIP-seq
MIRT1012577	hsa-miR-4277	CLIP-seq
MIRT1012578	hsa-miR-4289	CLIP-seq
MIRT1012579	hsa-miR-4291	CLIP-seq
MIRT1012580	hsa-miR-4297	CLIP-seq
MIRT1012581	hsa-miR-4299	CLIP-seq
MIRT1012582	hsa-miR-4310	CLIP-seq
MIRT1012583	hsa-miR-4318	CLIP-seq
MIRT1012584	hsa-miR-433	CLIP-seq
MIRT1012585	hsa-miR-4422	CLIP-seq
MIRT1012586	hsa-miR-4432	CLIP-seq
MIRT1012587	hsa-miR-4435	CLIP-seq
MIRT1012588	hsa-miR-4448	CLIP-seq
MIRT1012589	hsa-miR-4452	CLIP-seq
MIRT1012590	hsa-miR-4461	CLIP-seq
MIRT1012591	hsa-miR-4470	CLIP-seq
MIRT1012592	hsa-miR-4482	CLIP-seq
MIRT1012593	hsa-miR-4484	CLIP-seq
MIRT1012594	hsa-miR-4494	CLIP-seq
MIRT1012595	hsa-miR-4496	CLIP-seq
MIRT1012596	hsa-miR-449a	CLIP-seq
MIRT1012597	hsa-miR-449b	CLIP-seq
MIRT1012598	hsa-miR-449c	CLIP-seq
MIRT1012599	hsa-miR-450b-5p	CLIP-seq
MIRT1012600	hsa-miR-4517	CLIP-seq
MIRT1012601	hsa-miR-4519	CLIP-seq
MIRT1012602	hsa-miR-4632	CLIP-seq
MIRT1012603	hsa-miR-4642	CLIP-seq
MIRT1012604	hsa-miR-4646-3p	CLIP-seq
MIRT1012605	hsa-miR-4653-5p	CLIP-seq
MIRT1012606	hsa-miR-4659a-3p	CLIP-seq
MIRT1012607	hsa-miR-4659b-3p	CLIP-seq
MIRT1012608	hsa-miR-4666-3p	CLIP-seq
MIRT1012609	hsa-miR-4694-3p	CLIP-seq
MIRT1012610	hsa-miR-4698	CLIP-seq
MIRT1012611	hsa-miR-4709-5p	CLIP-seq
MIRT1012612	hsa-miR-4711-5p	CLIP-seq
MIRT1012613	hsa-miR-4713-5p	CLIP-seq
MIRT1012614	hsa-miR-4717-5p	CLIP-seq
MIRT1012615	hsa-miR-4719	CLIP-seq
MIRT1012616	hsa-miR-4722-5p	CLIP-seq
MIRT1012617	hsa-miR-4725-5p	CLIP-seq
MIRT1012618	hsa-miR-4727-5p	CLIP-seq
MIRT1012619	hsa-miR-4742-3p	CLIP-seq
MIRT1012620	hsa-miR-4766-5p	CLIP-seq
MIRT1012621	hsa-miR-4774-5p	CLIP-seq
MIRT1012622	hsa-miR-4775	CLIP-seq
MIRT1012623	hsa-miR-4778-3p	CLIP-seq
MIRT1012624	hsa-miR-4789-5p	CLIP-seq
MIRT1012625	hsa-miR-4791	CLIP-seq
MIRT1012626	hsa-miR-4795-3p	CLIP-seq
MIRT1012627	hsa-miR-4796-3p	CLIP-seq
MIRT1012628	hsa-miR-4803	CLIP-seq
MIRT1012629	hsa-miR-488	CLIP-seq
MIRT1012630	hsa-miR-494	CLIP-seq
MIRT1012631	hsa-miR-495	CLIP-seq
MIRT1012632	hsa-miR-499-5p	CLIP-seq
MIRT1012633	hsa-miR-504	CLIP-seq
MIRT1012634	hsa-miR-5095	CLIP-seq
MIRT1012635	hsa-miR-5096	CLIP-seq
MIRT1012636	hsa-miR-513a-3p	CLIP-seq
MIRT1012637	hsa-miR-513a-5p	CLIP-seq
MIRT1012638	hsa-miR-513b	CLIP-seq
MIRT1012639	hsa-miR-518a-5p	CLIP-seq
MIRT1012640	hsa-miR-520g	CLIP-seq
MIRT1012641	hsa-miR-520h	CLIP-seq
MIRT1012642	hsa-miR-527	CLIP-seq
MIRT1012643	hsa-miR-532-3p	CLIP-seq
MIRT1012644	hsa-miR-532-5p	CLIP-seq
MIRT1012645	hsa-miR-544	CLIP-seq
MIRT1012646	hsa-miR-548a-3p	CLIP-seq
MIRT1012647	hsa-miR-548al	CLIP-seq
MIRT1012648	hsa-miR-548an	CLIP-seq
MIRT1012649	hsa-miR-548e	CLIP-seq
MIRT1012650	hsa-miR-548f	CLIP-seq
MIRT1012651	hsa-miR-548o	CLIP-seq
MIRT1012652	hsa-miR-568	CLIP-seq
MIRT1012653	hsa-miR-582-3p	CLIP-seq
MIRT1012654	hsa-miR-590-3p	CLIP-seq
MIRT1012655	hsa-miR-600	CLIP-seq
MIRT1012656	hsa-miR-615-3p	CLIP-seq
MIRT1012657	hsa-miR-615-5p	CLIP-seq
MIRT1012658	hsa-miR-616	CLIP-seq
MIRT1012659	hsa-miR-656	CLIP-seq
MIRT1012660	hsa-miR-663b	CLIP-seq
MIRT1012661	hsa-miR-887	CLIP-seq
MIRT1012662	hsa-miR-95	CLIP-seq
MIRT1012506	hsa-miR-101	CLIP-seq
MIRT1012507	hsa-miR-10a	CLIP-seq
MIRT1012508	hsa-miR-10b	CLIP-seq
MIRT1012663	hsa-miR-1205	CLIP-seq
MIRT1012510	hsa-miR-1245	CLIP-seq
MIRT1012511	hsa-miR-1245b-5p	CLIP-seq
MIRT1012512	hsa-miR-1252	CLIP-seq
MIRT1012513	hsa-miR-1272	CLIP-seq
MIRT1012514	hsa-miR-1273g	CLIP-seq
MIRT1012515	hsa-miR-128	CLIP-seq
MIRT1012516	hsa-miR-1286	CLIP-seq
MIRT1012664	hsa-miR-1288	CLIP-seq
MIRT1012665	hsa-miR-1291	CLIP-seq
MIRT1012517	hsa-miR-1295	CLIP-seq
MIRT1012518	hsa-miR-1322	CLIP-seq
MIRT1012519	hsa-miR-1323	CLIP-seq
MIRT1012520	hsa-miR-135a	CLIP-seq
MIRT1012521	hsa-miR-135b	CLIP-seq
MIRT1012522	hsa-miR-140-3p	CLIP-seq
MIRT1012523	hsa-miR-140-5p	CLIP-seq
MIRT1012524	hsa-miR-141	CLIP-seq
MIRT1012525	hsa-miR-142-5p	CLIP-seq
MIRT1012526	hsa-miR-144	CLIP-seq
MIRT1012666	hsa-miR-146b-3p	CLIP-seq
MIRT1012527	hsa-miR-1470	CLIP-seq
MIRT1012528	hsa-miR-150	CLIP-seq
MIRT1012529	hsa-miR-155	CLIP-seq
MIRT1012667	hsa-miR-1909	CLIP-seq
MIRT1012531	hsa-miR-1912	CLIP-seq
MIRT1012668	hsa-miR-1976	CLIP-seq
MIRT1012532	hsa-miR-198	CLIP-seq
MIRT1012533	hsa-miR-200a	CLIP-seq
MIRT1012534	hsa-miR-205	CLIP-seq
MIRT1012535	hsa-miR-208a	CLIP-seq
MIRT1012536	hsa-miR-208b	CLIP-seq
MIRT1012537	hsa-miR-2116	CLIP-seq
MIRT1012538	hsa-miR-2355-3p	CLIP-seq
MIRT1012539	hsa-miR-2467-3p	CLIP-seq
MIRT1012540	hsa-miR-2682	CLIP-seq
MIRT1012541	hsa-miR-27a	CLIP-seq
MIRT1012542	hsa-miR-27b	CLIP-seq
MIRT1012543	hsa-miR-300	CLIP-seq
MIRT1012669	hsa-miR-3065-3p	CLIP-seq
MIRT1012544	hsa-miR-3074-3p	CLIP-seq
MIRT1012545	hsa-miR-3121-3p	CLIP-seq
MIRT1012546	hsa-miR-3121-5p	CLIP-seq
MIRT1012547	hsa-miR-3130-5p	CLIP-seq
MIRT1012548	hsa-miR-3142	CLIP-seq
MIRT1012550	hsa-miR-3160-5p	CLIP-seq
MIRT1012670	hsa-miR-3199	CLIP-seq
MIRT1012551	hsa-miR-3201	CLIP-seq
MIRT1012552	hsa-miR-330-3p	CLIP-seq
MIRT1012553	hsa-miR-338-5p	CLIP-seq
MIRT1012554	hsa-miR-34a	CLIP-seq
MIRT1012555	hsa-miR-34c-3p	CLIP-seq
MIRT1012556	hsa-miR-34c-5p	CLIP-seq
MIRT1012558	hsa-miR-361-5p	CLIP-seq
MIRT1012559	hsa-miR-3670	CLIP-seq
MIRT1012560	hsa-miR-3678-3p	CLIP-seq
MIRT1012562	hsa-miR-3688-5p	CLIP-seq
MIRT1012563	hsa-miR-3692	CLIP-seq
MIRT1012564	hsa-miR-369-3p	CLIP-seq
MIRT1012565	hsa-miR-3714	CLIP-seq
MIRT1012566	hsa-miR-374a	CLIP-seq
MIRT1012567	hsa-miR-374b	CLIP-seq
MIRT1012568	hsa-miR-380	CLIP-seq
MIRT1012569	hsa-miR-381	CLIP-seq
MIRT1012570	hsa-miR-3907	CLIP-seq
MIRT1012572	hsa-miR-4261	CLIP-seq
MIRT1012671	hsa-miR-4268	CLIP-seq
MIRT1012573	hsa-miR-4272	CLIP-seq
MIRT1012574	hsa-miR-4274	CLIP-seq
MIRT1012575	hsa-miR-4275	CLIP-seq
MIRT1012576	hsa-miR-4276	CLIP-seq
MIRT1012577	hsa-miR-4277	CLIP-seq
MIRT1012578	hsa-miR-4289	CLIP-seq
MIRT1012579	hsa-miR-4291	CLIP-seq
MIRT1012580	hsa-miR-4297	CLIP-seq
MIRT1012581	hsa-miR-4299	CLIP-seq
MIRT1012582	hsa-miR-4310	CLIP-seq
MIRT1012583	hsa-miR-4318	CLIP-seq
MIRT1012584	hsa-miR-433	CLIP-seq
MIRT1012672	hsa-miR-4418	CLIP-seq
MIRT1012585	hsa-miR-4422	CLIP-seq
MIRT1012586	hsa-miR-4432	CLIP-seq
MIRT1012587	hsa-miR-4435	CLIP-seq
MIRT1012673	hsa-miR-4438	CLIP-seq
MIRT1012588	hsa-miR-4448	CLIP-seq
MIRT1012589	hsa-miR-4452	CLIP-seq
MIRT1012590	hsa-miR-4461	CLIP-seq
MIRT1012591	hsa-miR-4470	CLIP-seq
MIRT1012674	hsa-miR-4475	CLIP-seq
MIRT1012592	hsa-miR-4482	CLIP-seq
MIRT1012593	hsa-miR-4484	CLIP-seq
MIRT1012675	hsa-miR-4488	CLIP-seq
MIRT1012594	hsa-miR-4494	CLIP-seq
MIRT1012595	hsa-miR-4496	CLIP-seq
MIRT1012596	hsa-miR-449a	CLIP-seq
MIRT1012597	hsa-miR-449b	CLIP-seq
MIRT1012598	hsa-miR-449c	CLIP-seq
MIRT1012599	hsa-miR-450b-5p	CLIP-seq
MIRT1012600	hsa-miR-4517	CLIP-seq
MIRT1012601	hsa-miR-4519	CLIP-seq
MIRT1012603	hsa-miR-4642	CLIP-seq
MIRT1012604	hsa-miR-4646-3p	CLIP-seq
MIRT1012606	hsa-miR-4659a-3p	CLIP-seq
MIRT1012607	hsa-miR-4659b-3p	CLIP-seq
MIRT1012608	hsa-miR-4666-3p	CLIP-seq
MIRT1012676	hsa-miR-4677-3p	CLIP-seq
MIRT1012677	hsa-miR-4697-5p	CLIP-seq
MIRT1012611	hsa-miR-4709-5p	CLIP-seq
MIRT1012612	hsa-miR-4711-5p	CLIP-seq
MIRT1012613	hsa-miR-4713-5p	CLIP-seq
MIRT1012614	hsa-miR-4717-5p	CLIP-seq
MIRT1012615	hsa-miR-4719	CLIP-seq
MIRT1012616	hsa-miR-4722-5p	CLIP-seq
MIRT1012617	hsa-miR-4725-5p	CLIP-seq
MIRT1012618	hsa-miR-4727-5p	CLIP-seq
MIRT1012678	hsa-miR-4731-5p	CLIP-seq
MIRT1012619	hsa-miR-4742-3p	CLIP-seq
MIRT1012621	hsa-miR-4774-5p	CLIP-seq
MIRT1012622	hsa-miR-4775	CLIP-seq
MIRT1012623	hsa-miR-4778-3p	CLIP-seq
MIRT1012624	hsa-miR-4789-5p	CLIP-seq
MIRT1012625	hsa-miR-4791	CLIP-seq
MIRT1012626	hsa-miR-4795-3p	CLIP-seq
MIRT1012627	hsa-miR-4796-3p	CLIP-seq
MIRT1012628	hsa-miR-4803	CLIP-seq
MIRT1012679	hsa-miR-485-3p	CLIP-seq
MIRT1012629	hsa-miR-488	CLIP-seq
MIRT1012631	hsa-miR-495	CLIP-seq
MIRT1012632	hsa-miR-499-5p	CLIP-seq
MIRT1012633	hsa-miR-504	CLIP-seq
MIRT1012680	hsa-miR-509-3-5p	CLIP-seq
MIRT1012634	hsa-miR-5095	CLIP-seq
MIRT1012681	hsa-miR-509-5p	CLIP-seq
MIRT1012635	hsa-miR-5096	CLIP-seq
MIRT1012636	hsa-miR-513a-3p	CLIP-seq
MIRT1012637	hsa-miR-513a-5p	CLIP-seq
MIRT1012638	hsa-miR-513b	CLIP-seq
MIRT1012639	hsa-miR-518a-5p	CLIP-seq
MIRT1012640	hsa-miR-520g	CLIP-seq
MIRT1012641	hsa-miR-520h	CLIP-seq
MIRT1012642	hsa-miR-527	CLIP-seq
MIRT1012643	hsa-miR-532-3p	CLIP-seq
MIRT1012644	hsa-miR-532-5p	CLIP-seq
MIRT1012645	hsa-miR-544	CLIP-seq
MIRT1012646	hsa-miR-548a-3p	CLIP-seq
MIRT1012647	hsa-miR-548al	CLIP-seq
MIRT1012648	hsa-miR-548an	CLIP-seq
MIRT1012649	hsa-miR-548e	CLIP-seq
MIRT1012650	hsa-miR-548f	CLIP-seq
MIRT1012651	hsa-miR-548o	CLIP-seq
MIRT1012652	hsa-miR-568	CLIP-seq
MIRT1012653	hsa-miR-582-3p	CLIP-seq
MIRT1012654	hsa-miR-590-3p	CLIP-seq
MIRT1012655	hsa-miR-600	CLIP-seq
MIRT1012656	hsa-miR-615-3p	CLIP-seq
MIRT1012657	hsa-miR-615-5p	CLIP-seq
MIRT1012658	hsa-miR-616	CLIP-seq
MIRT1012682	hsa-miR-637	CLIP-seq
MIRT1012659	hsa-miR-656	CLIP-seq
MIRT1012660	hsa-miR-663b	CLIP-seq
MIRT1012683	hsa-miR-720	CLIP-seq
MIRT1012661	hsa-miR-887	CLIP-seq
MIRT1012662	hsa-miR-95	CLIP-seq
MIRT1012619	hsa-miR-4742-3p	CLIP-seq
MIRT1012624	hsa-miR-4789-5p	CLIP-seq
MIRT1012506	hsa-miR-101	CLIP-seq
MIRT1012507	hsa-miR-10a	CLIP-seq
MIRT1012508	hsa-miR-10b	CLIP-seq
MIRT1012663	hsa-miR-1205	CLIP-seq
MIRT1012511	hsa-miR-1245b-5p	CLIP-seq
MIRT1012513	hsa-miR-1272	CLIP-seq
MIRT1012514	hsa-miR-1273g	CLIP-seq
MIRT1012515	hsa-miR-128	CLIP-seq
MIRT1012516	hsa-miR-1286	CLIP-seq
MIRT1012664	hsa-miR-1288	CLIP-seq
MIRT1012517	hsa-miR-1295	CLIP-seq
MIRT1012518	hsa-miR-1322	CLIP-seq
MIRT1012519	hsa-miR-1323	CLIP-seq
MIRT1012520	hsa-miR-135a	CLIP-seq
MIRT1012521	hsa-miR-135b	CLIP-seq
MIRT1012522	hsa-miR-140-3p	CLIP-seq
MIRT1012523	hsa-miR-140-5p	CLIP-seq
MIRT1012525	hsa-miR-142-5p	CLIP-seq
MIRT1012526	hsa-miR-144	CLIP-seq
MIRT1012527	hsa-miR-1470	CLIP-seq
MIRT1012529	hsa-miR-155	CLIP-seq
MIRT1012530	hsa-miR-1827	CLIP-seq
MIRT1012667	hsa-miR-1909	CLIP-seq
MIRT1012531	hsa-miR-1912	CLIP-seq
MIRT1012668	hsa-miR-1976	CLIP-seq
MIRT1012532	hsa-miR-198	CLIP-seq
MIRT1012534	hsa-miR-205	CLIP-seq
MIRT1012535	hsa-miR-208a	CLIP-seq
MIRT1012536	hsa-miR-208b	CLIP-seq
MIRT1012537	hsa-miR-2116	CLIP-seq
MIRT1012538	hsa-miR-2355-3p	CLIP-seq
MIRT1012539	hsa-miR-2467-3p	CLIP-seq
MIRT1012541	hsa-miR-27a	CLIP-seq
MIRT1012542	hsa-miR-27b	CLIP-seq
MIRT1012543	hsa-miR-300	CLIP-seq
MIRT1012669	hsa-miR-3065-3p	CLIP-seq
MIRT1012544	hsa-miR-3074-3p	CLIP-seq
MIRT1012545	hsa-miR-3121-3p	CLIP-seq
MIRT1012546	hsa-miR-3121-5p	CLIP-seq
MIRT1012547	hsa-miR-3130-5p	CLIP-seq
MIRT1012548	hsa-miR-3142	CLIP-seq
MIRT1012549	hsa-miR-3148	CLIP-seq
MIRT1012550	hsa-miR-3160-5p	CLIP-seq
MIRT1012670	hsa-miR-3199	CLIP-seq
MIRT1012551	hsa-miR-3201	CLIP-seq
MIRT1012552	hsa-miR-330-3p	CLIP-seq
MIRT1012553	hsa-miR-338-5p	CLIP-seq
MIRT1012554	hsa-miR-34a	CLIP-seq
MIRT1012556	hsa-miR-34c-5p	CLIP-seq
MIRT1012557	hsa-miR-3613-3p	CLIP-seq
MIRT1012558	hsa-miR-361-5p	CLIP-seq
MIRT1012559	hsa-miR-3670	CLIP-seq
MIRT1012560	hsa-miR-3678-3p	CLIP-seq
MIRT1012561	hsa-miR-3688-3p	CLIP-seq
MIRT1012562	hsa-miR-3688-5p	CLIP-seq
MIRT1012564	hsa-miR-369-3p	CLIP-seq
MIRT1012566	hsa-miR-374a	CLIP-seq
MIRT1012567	hsa-miR-374b	CLIP-seq
MIRT1012568	hsa-miR-380	CLIP-seq
MIRT1012569	hsa-miR-381	CLIP-seq
MIRT1012570	hsa-miR-3907	CLIP-seq
MIRT1012571	hsa-miR-3921	CLIP-seq
MIRT1012572	hsa-miR-4261	CLIP-seq
MIRT1012671	hsa-miR-4268	CLIP-seq
MIRT1012573	hsa-miR-4272	CLIP-seq
MIRT1012574	hsa-miR-4274	CLIP-seq
MIRT1012575	hsa-miR-4275	CLIP-seq
MIRT1012576	hsa-miR-4276	CLIP-seq
MIRT1012577	hsa-miR-4277	CLIP-seq
MIRT1012578	hsa-miR-4289	CLIP-seq
MIRT1012579	hsa-miR-4291	CLIP-seq
MIRT1012580	hsa-miR-4297	CLIP-seq
MIRT1012581	hsa-miR-4299	CLIP-seq
MIRT1012582	hsa-miR-4310	CLIP-seq
MIRT1012583	hsa-miR-4318	CLIP-seq
MIRT1012584	hsa-miR-433	CLIP-seq
MIRT1012672	hsa-miR-4418	CLIP-seq
MIRT1012585	hsa-miR-4422	CLIP-seq
MIRT1012586	hsa-miR-4432	CLIP-seq
MIRT1012587	hsa-miR-4435	CLIP-seq
MIRT1012673	hsa-miR-4438	CLIP-seq
MIRT1012588	hsa-miR-4448	CLIP-seq
MIRT1012589	hsa-miR-4452	CLIP-seq
MIRT1012591	hsa-miR-4470	CLIP-seq
MIRT1012674	hsa-miR-4475	CLIP-seq
MIRT1012592	hsa-miR-4482	CLIP-seq
MIRT1012595	hsa-miR-4496	CLIP-seq
MIRT1012596	hsa-miR-449a	CLIP-seq
MIRT1012597	hsa-miR-449b	CLIP-seq
MIRT1012599	hsa-miR-450b-5p	CLIP-seq
MIRT1012600	hsa-miR-4517	CLIP-seq
MIRT1012601	hsa-miR-4519	CLIP-seq
MIRT1012602	hsa-miR-4632	CLIP-seq
MIRT1012603	hsa-miR-4642	CLIP-seq
MIRT1012604	hsa-miR-4646-3p	CLIP-seq
MIRT1012605	hsa-miR-4653-5p	CLIP-seq
MIRT1012606	hsa-miR-4659a-3p	CLIP-seq
MIRT1012607	hsa-miR-4659b-3p	CLIP-seq
MIRT1012608	hsa-miR-4666-3p	CLIP-seq
MIRT1012609	hsa-miR-4694-3p	CLIP-seq
MIRT1012610	hsa-miR-4698	CLIP-seq
MIRT1012611	hsa-miR-4709-5p	CLIP-seq
MIRT1012612	hsa-miR-4711-5p	CLIP-seq
MIRT1012614	hsa-miR-4717-5p	CLIP-seq
MIRT1012615	hsa-miR-4719	CLIP-seq
MIRT1012616	hsa-miR-4722-5p	CLIP-seq
MIRT1012617	hsa-miR-4725-5p	CLIP-seq
MIRT1012618	hsa-miR-4727-5p	CLIP-seq
MIRT1012619	hsa-miR-4742-3p	CLIP-seq
MIRT1012620	hsa-miR-4766-5p	CLIP-seq
MIRT1012621	hsa-miR-4774-5p	CLIP-seq
MIRT1012622	hsa-miR-4775	CLIP-seq
MIRT1012623	hsa-miR-4778-3p	CLIP-seq
MIRT1012624	hsa-miR-4789-5p	CLIP-seq
MIRT1012625	hsa-miR-4791	CLIP-seq
MIRT1012626	hsa-miR-4795-3p	CLIP-seq
MIRT1012627	hsa-miR-4796-3p	CLIP-seq
MIRT1012628	hsa-miR-4803	CLIP-seq
MIRT1012679	hsa-miR-485-3p	CLIP-seq
MIRT1012629	hsa-miR-488	CLIP-seq
MIRT1012631	hsa-miR-495	CLIP-seq
MIRT1012632	hsa-miR-499-5p	CLIP-seq
MIRT1012633	hsa-miR-504	CLIP-seq
MIRT1012680	hsa-miR-509-3-5p	CLIP-seq
MIRT1012634	hsa-miR-5095	CLIP-seq
MIRT1012681	hsa-miR-509-5p	CLIP-seq
MIRT1012635	hsa-miR-5096	CLIP-seq
MIRT1012636	hsa-miR-513a-3p	CLIP-seq
MIRT1012637	hsa-miR-513a-5p	CLIP-seq
MIRT1012638	hsa-miR-513b	CLIP-seq
MIRT1012639	hsa-miR-518a-5p	CLIP-seq
MIRT1012640	hsa-miR-520g	CLIP-seq
MIRT1012641	hsa-miR-520h	CLIP-seq
MIRT1012642	hsa-miR-527	CLIP-seq
MIRT1012644	hsa-miR-532-5p	CLIP-seq
MIRT1012645	hsa-miR-544	CLIP-seq
MIRT1012646	hsa-miR-548a-3p	CLIP-seq
MIRT1012647	hsa-miR-548al	CLIP-seq
MIRT1012649	hsa-miR-548e	CLIP-seq
MIRT1012650	hsa-miR-548f	CLIP-seq
MIRT1012651	hsa-miR-548o	CLIP-seq
MIRT1012652	hsa-miR-568	CLIP-seq
MIRT1012653	hsa-miR-582-3p	CLIP-seq
MIRT1012654	hsa-miR-590-3p	CLIP-seq
MIRT1012655	hsa-miR-600	CLIP-seq
MIRT1012656	hsa-miR-615-3p	CLIP-seq
MIRT1012657	hsa-miR-615-5p	CLIP-seq
MIRT1012658	hsa-miR-616	CLIP-seq
MIRT1012660	hsa-miR-663b	CLIP-seq
MIRT1012661	hsa-miR-887	CLIP-seq
MIRT1012662	hsa-miR-95	CLIP-seq
MIRT1012507	hsa-miR-10a	CLIP-seq
MIRT1012508	hsa-miR-10b	CLIP-seq
MIRT1012510	hsa-miR-1245	CLIP-seq
MIRT1012514	hsa-miR-1273g	CLIP-seq
MIRT1012520	hsa-miR-135a	CLIP-seq
MIRT1012521	hsa-miR-135b	CLIP-seq
MIRT1012523	hsa-miR-140-5p	CLIP-seq
MIRT1012532	hsa-miR-198	CLIP-seq
MIRT1012540	hsa-miR-2682	CLIP-seq
MIRT1012541	hsa-miR-27a	CLIP-seq
MIRT1012542	hsa-miR-27b	CLIP-seq
MIRT1012545	hsa-miR-3121-3p	CLIP-seq
MIRT1012551	hsa-miR-3201	CLIP-seq
MIRT1012554	hsa-miR-34a	CLIP-seq
MIRT1012555	hsa-miR-34c-3p	CLIP-seq
MIRT1012556	hsa-miR-34c-5p	CLIP-seq
MIRT1012565	hsa-miR-3714	CLIP-seq
MIRT1012576	hsa-miR-4276	CLIP-seq
MIRT1012593	hsa-miR-4484	CLIP-seq
MIRT1012596	hsa-miR-449a	CLIP-seq
MIRT1012597	hsa-miR-449b	CLIP-seq
MIRT1012598	hsa-miR-449c	CLIP-seq
MIRT1012617	hsa-miR-4725-5p	CLIP-seq
MIRT1012625	hsa-miR-4791	CLIP-seq
MIRT1012633	hsa-miR-504	CLIP-seq
MIRT1012635	hsa-miR-5096	CLIP-seq
MIRT1012637	hsa-miR-513a-5p	CLIP-seq
MIRT1012648	hsa-miR-548an	CLIP-seq
MIRT1012657	hsa-miR-615-5p	CLIP-seq
MIRT1012619	hsa-miR-4742-3p	CLIP-seq
MIRT1012624	hsa-miR-4789-5p	CLIP-seq
MIRT1012663	hsa-miR-1205	CLIP-seq
MIRT1012516	hsa-miR-1286	CLIP-seq
MIRT1012673	hsa-miR-4438	CLIP-seq
MIRT1012616	hsa-miR-4722-5p	CLIP-seq

Show/Hide all (9)

Transcription factor	Regulation	Reference
GATA3	Unknown	20484083
MEN1	Unknown	20484083
MYB	Unknown	20484083
NFKB1	Activation	20660789
RELA	Activation	20660789
SATB1	Activation	20126258
SP1	Unknown	15486968
TBX21	Unknown	17075044
TCF7L2	Unknown	22951069

214

Show/Hide all (214)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IBA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000785	Component	Chromatin	IDA	20855495
GO:0000785	Component	Chromatin	ISA
GO:0000902	Process	Cell morphogenesis	IEA
GO:0000976	Function	Transcription cis-regulatory region binding	IDA	19723756, 19735555, 19805038, 20189993, 20484083
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IEA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	19674970
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IDA	20484083
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0000987	Function	Cis-regulatory region sequence-specific DNA binding	IDA	19232384
GO:0000987	Function	Cis-regulatory region sequence-specific DNA binding	IEA
GO:0001223	Function	Transcription coactivator binding	IEA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IMP	19674970
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	2017177
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0001701	Process	In utero embryonic development	IEA
GO:0001709	Process	Cell fate determination	IEA
GO:0001709	Process	Cell fate determination	ISS
GO:0001764	Process	Neuron migration	IEA
GO:0001775	Process	Cell activation	IEA
GO:0001806	Process	Type IV hypersensitivity	IEA
GO:0001817	Process	Regulation of cytokine production	IEA
GO:0001817	Process	Regulation of cytokine production	ISS
GO:0001819	Process	Positive regulation of cytokine production	IEA
GO:0001822	Process	Kidney development	IMP	19248180, 19723756
GO:0001823	Process	Mesonephros development	IEA
GO:0001823	Process	Mesonephros development	ISS
GO:0002088	Process	Lens development in camera-type eye	IEA
GO:0002376	Process	Immune system process	IEA
GO:0002520	Process	Immune system development	IBA
GO:0002572	Process	Pro-T cell differentiation	IEA
GO:0003180	Process	Aortic valve morphogenesis	IEA
GO:0003180	Process	Aortic valve morphogenesis	ISS
GO:0003215	Process	Cardiac right ventricle morphogenesis	IEA
GO:0003215	Process	Cardiac right ventricle morphogenesis	ISS
GO:0003281	Process	Ventricular septum development	IEA
GO:0003281	Process	Ventricular septum development	ISS
GO:0003677	Function	DNA binding	IEA
GO:0003677	Function	DNA binding	TAS	1871134
GO:0003700	Function	DNA-binding transcription factor activity	IDA	19232384, 19805038, 20189993
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IMP	19674970, 20368097
GO:0003700	Function	DNA-binding transcription factor activity	TAS	2050118, 8088776
GO:0005134	Function	Interleukin-2 receptor binding	IEA
GO:0005515	Function	Protein binding	IPI	15662016, 17075044, 19674970, 19723756, 20484083, 25416956, 25910212, 26028330, 26871637, 26899996, 28263977, 32296183, 32814053
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	19674970, 19723756, 20189993, 22529382
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0006338	Process	Chromatin remodeling	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0006366	Process	Transcription by RNA polymerase II	IEA
GO:0006952	Process	Defense response	TAS	7592673
GO:0006954	Process	Inflammatory response	IEA
GO:0006954	Process	Inflammatory response	ISS
GO:0006959	Process	Humoral immune response	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007165	Process	Signal transduction	ISS
GO:0007399	Process	Nervous system development	IEA
GO:0007411	Process	Axon guidance	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0008283	Process	Cell population proliferation	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	ISS
GO:0008584	Process	Male gonad development	IEA
GO:0008584	Process	Male gonad development	ISS
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0009615	Process	Response to virus	IEP	20583921
GO:0009653	Process	Anatomical structure morphogenesis	IEA
GO:0009653	Process	Anatomical structure morphogenesis	TAS	10935639
GO:0009791	Process	Post-embryonic development	IEA
GO:0009967	Process	Positive regulation of signal transduction	IMP	19674970
GO:0010332	Process	Response to gamma radiation	IEA
GO:0010467	Process	Gene expression	IEA
GO:0010595	Process	Positive regulation of endothelial cell migration	IMP	19674970
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0010629	Process	Negative regulation of gene expression	IEA
GO:0010719	Process	Negative regulation of epithelial to mesenchymal transition	IMP	26451614
GO:0010975	Process	Regulation of neuron projection development	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0030182	Process	Neuron differentiation	IEA
GO:0030217	Process	T cell differentiation	IDA	2017177
GO:0030217	Process	T cell differentiation	IEA
GO:0030218	Process	Erythrocyte differentiation	IEA
GO:0030225	Process	Macrophage differentiation	IEA
GO:0030225	Process	Macrophage differentiation	ISS
GO:0030856	Process	Regulation of epithelial cell differentiation	IBA
GO:0031929	Process	TOR signaling	IEA
GO:0031929	Process	TOR signaling	ISS
GO:0032689	Process	Negative regulation of type II interferon production	IEA
GO:0032703	Process	Negative regulation of interleukin-2 production	IEA
GO:0032736	Process	Positive regulation of interleukin-13 production	IDA	20554961
GO:0032736	Process	Positive regulation of interleukin-13 production	IEA
GO:0032736	Process	Positive regulation of interleukin-13 production	IMP	20368097
GO:0032753	Process	Positive regulation of interleukin-4 production	IEA
GO:0032753	Process	Positive regulation of interleukin-4 production	ISS
GO:0032754	Process	Positive regulation of interleukin-5 production	IDA	20554961
GO:0032754	Process	Positive regulation of interleukin-5 production	IEA
GO:0033077	Process	T cell differentiation in thymus	IEA
GO:0033600	Process	Negative regulation of mammary gland epithelial cell proliferation	IDA	19483726
GO:0035162	Process	Embryonic hemopoiesis	IEA
GO:0035457	Process	Cellular response to interferon-alpha	IEP	20554961
GO:0035799	Process	Ureter maturation	IEA
GO:0035898	Process	Parathyroid hormone secretion	IEA
GO:0042421	Process	Norepinephrine biosynthetic process	IEA
GO:0042421	Process	Norepinephrine biosynthetic process	ISS
GO:0042472	Process	Inner ear morphogenesis	IEA
GO:0042802	Function	Identical protein binding	IEA
GO:0043491	Process	Phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA
GO:0043491	Process	Phosphatidylinositol 3-kinase/protein kinase B signal transduction	ISS
GO:0043523	Process	Regulation of neuron apoptotic process	IEA
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0043583	Process	Ear development	IMP	19248180, 19723756
GO:0043627	Process	Response to estrogen	IEP	10037815
GO:0045061	Process	Thymic T cell selection	IEA
GO:0045064	Process	T-helper 2 cell differentiation	IDA	20484083
GO:0045064	Process	T-helper 2 cell differentiation	IEA
GO:0045087	Process	Innate immune response	IEA
GO:0045165	Process	Cell fate commitment	IBA
GO:0045471	Process	Response to ethanol	IEA
GO:0045582	Process	Positive regulation of T cell differentiation	IEA
GO:0045582	Process	Positive regulation of T cell differentiation	ISS
GO:0045597	Process	Positive regulation of cell differentiation	IEA
GO:0045622	Process	Regulation of T-helper cell differentiation	IEA
GO:0045786	Process	Negative regulation of cell cycle	IEA
GO:0045786	Process	Negative regulation of cell cycle	IMP	20189993
GO:0045892	Process	Negative regulation of DNA-templated transcription	IMP	19674970
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	19723756, 19805038
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IMP	19674970, 20368097
GO:0045893	Process	Positive regulation of DNA-templated transcription	ISS
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	2017177
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	2017177, 19232384, 20189993, 20484083
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	20855495
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0046872	Function	Metal ion binding	IEA
GO:0048469	Process	Cell maturation	IEA
GO:0048485	Process	Sympathetic nervous system development	IEA
GO:0048485	Process	Sympathetic nervous system development	ISS
GO:0048538	Process	Thymus development	IEA
GO:0048568	Process	Embryonic organ development	IBA
GO:0048568	Process	Embryonic organ development	IEA
GO:0048589	Process	Developmental growth	IEA
GO:0048646	Process	Anatomical structure formation involved in morphogenesis	IEA
GO:0048646	Process	Anatomical structure formation involved in morphogenesis	ISS
GO:0048731	Process	System development	IEA
GO:0048872	Process	Homeostasis of number of cells	IEA
GO:0050728	Process	Negative regulation of inflammatory response	IMP	19674970
GO:0050793	Process	Regulation of developmental process	IEA
GO:0050852	Process	T cell receptor signaling pathway	IEA
GO:0050852	Process	T cell receptor signaling pathway	ISS
GO:0051216	Process	Cartilage development	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IMP	19674970
GO:0060017	Process	Parathyroid gland development	IEA
GO:0060037	Process	Pharyngeal system development	IEA
GO:0060037	Process	Pharyngeal system development	ISS
GO:0060065	Process	Uterus development	IEA
GO:0060065	Process	Uterus development	ISS
GO:0060070	Process	Canonical Wnt signaling pathway	IEA
GO:0060070	Process	Canonical Wnt signaling pathway	ISS
GO:0060231	Process	Mesenchymal to epithelial transition	IDA	20189993
GO:0060374	Process	Mast cell differentiation	IEA
GO:0060676	Process	Ureteric bud formation	IEA
GO:0060676	Process	Ureteric bud formation	ISS
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IPI	15016828
GO:0070888	Function	E-box binding	IDA	20855495
GO:0071345	Process	Cellular response to cytokine stimulus	IEA
GO:0071353	Process	Cellular response to interleukin-4	IEA
GO:0071353	Process	Cellular response to interleukin-4	IEP	20554961
GO:0071356	Process	Cellular response to tumor necrosis factor	IEP	19674970
GO:0071599	Process	Otic vesicle development	IEA
GO:0071773	Process	Cellular response to BMP stimulus	IEA
GO:0071837	Function	HMG box domain binding	IPI	18445004
GO:0072107	Process	Positive regulation of ureteric bud formation	IEA
GO:0072107	Process	Positive regulation of ureteric bud formation	ISS
GO:0072178	Process	Nephric duct morphogenesis	IEA
GO:0072178	Process	Nephric duct morphogenesis	ISS
GO:0072179	Process	Nephric duct formation	IEA
GO:0072179	Process	Nephric duct formation	ISS
GO:0072182	Process	Regulation of nephron tubule epithelial cell differentiation	IEA
GO:0072182	Process	Regulation of nephron tubule epithelial cell differentiation	ISS
GO:0072197	Process	Ureter morphogenesis	IEA
GO:0072676	Process	Lymphocyte migration	IDA	19805038
GO:0090102	Process	Cochlea development	IEA
GO:1902895	Process	Positive regulation of miRNA transcription	IDA	26451614
GO:1990226	Function	Histone methyltransferase binding	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IEA
GO:2000114	Process	Regulation of establishment of cell polarity	IEA
GO:2000146	Process	Negative regulation of cell motility	IMP	20189993
GO:2000352	Process	Negative regulation of endothelial cell apoptotic process	IMP	19674970
GO:2000553	Process	Positive regulation of T-helper 2 cell cytokine production	IEA
GO:2000607	Process	Negative regulation of cell proliferation involved in mesonephros development	IEA
GO:2000607	Process	Negative regulation of cell proliferation involved in mesonephros development	ISS
GO:2000611	Process	Positive regulation of thyroid hormone generation	IMP	19248180, 19723756
GO:2000679	Process	Positive regulation of transcription regulatory region DNA binding	IMP	20368097
GO:2000683	Process	Regulation of cellular response to X-ray	IMP	19735555
GO:2000703	Process	Negative regulation of fibroblast growth factor receptor signaling pathway involved in ureteric bud formation	IEA
GO:2000703	Process	Negative regulation of fibroblast growth factor receptor signaling pathway involved in ureteric bud formation	ISS
GO:2000734	Process	Negative regulation of glial cell-derived neurotrophic factor receptor signaling pathway involved in ureteric bud formation	IEA
GO:2000734	Process	Negative regulation of glial cell-derived neurotrophic factor receptor signaling pathway involved in ureteric bud formation	ISS

MIM	HGNC	e!Ensembl
131320	4172	ENSG00000107485

P23771

Protein name

Trans-acting T-cell-specific transcription factor GATA-3 (GATA-binding factor 3)

Protein function

Transcriptional activator which binds to the enhancer of the T-cell receptor alpha and delta genes. Binds to the consensus sequence 5'-AGATAG-3'. Required for the T-helper 2 (Th2) differentiation process following immune and inflammatory respons

PDB

4HC7 , 4HC9 , 4HCA

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00320	GATA	263 → 297	GATA zinc finger	Domain
PF00320	GATA	317 → 351	GATA zinc finger	Domain

Tissue specificity

TISSUE SPECIFICITY: T-cells and endothelial cells.

Sequence

MEVTADQPRWVSHHHPAVLNGQHPDTHHPGLSHSYMDAAQYPLPEEVDVLFNIDGQGNHV
PPYYGNSVRATVQRYPPTHHGSQVCRPPLLHGSLPWLDGGKALGSHHTASPWNLSPFSKT
SIHHGSPGPLSVYPPASSSSLSGGHASPHLFTFPPTPPKDVSPDPSLSTPGSAGSARQDE
KECLKYQVPLPDSMKLESSHSRGSMTALGGASSSTHHPITTYPPYVPEYSSGLFPPSSLL
GGSPTGFGCKSRPKARSSTGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPL
IKPKRRLSAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKEG
IQTRNRKMSSKSKKCKKVHDSLEDFPKNSSFNPAALSRHMSSLSHISPFSHSSHMLTTPT
PMHPPSSLSFGPHHPSSMVTAMG

Sequence length

443

Interactions

View interactions

	KEGG		Reactome
	Th1 and Th2 cell differentiation Th17 cell differentiation Parathyroid hormone synthesis, secretion and action Inflammatory bowel disease		Ub-specific processing proteases Interleukin-4 and Interleukin-13 signaling RUNX1 regulates transcription of genes involved in differentiation of HSCs Estrogen-dependent gene expression Factors involved in megakaryocyte development and platelet production

216

Show/Hide Causal Diseases (10)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Congenital anomaly of kidney and urinary tract	Likely pathogenic	rs1832899364	RCV001328306
Deafness, autosomal dominant	Pathogenic	rs2491461355	RCV003155569
Familial cancer of breast	Pathogenic	rs763236375, rs112417755	RCV005869746 RCV005899790
GATA3-related disorder	Pathogenic; Likely pathogenic	rs772396478, rs2491461857, rs112417755, rs1588377948	RCV004731212 RCV003982547 RCV004730959 RCV003892163
Hearing impairment	Likely pathogenic	rs2131482893	RCV001375170
Hypoparathyroidism, deafness, renal disease syndrome	Pathogenic; Likely pathogenic	rs2131488953, rs746122348, rs2131511714, rs2131491404, rs763575837, rs2131488650, rs2131500277, rs772396478, rs1832899364, rs766098800, rs2131488863, rs763236375, rs111283999, rs2131501118, rs878853222 View all (24 more)	RCV001375869 RCV001527690 RCV001527691 RCV001799520 RCV001822880 RCV001823288 RCV001783345 RCV002051993 RCV003155447 RCV005235638 RCV002250007 RCV002250008 RCV002471647 RCV005227806 RCV005869989 RCV000225007 RCV003238173 RCV003333552 RCV000018100 RCV000018101 RCV000018103 RCV000018104 RCV000018105 RCV000018106 RCV000018107 RCV000018108 RCV000018109 RCV003985126 RCV003991235 RCV004584162 RCV004593582 RCV000022538 RCV000022539 RCV005252919 RCV000709930 RCV001078192 RCV000988325 RCV001089562 RCV001089964 RCV001197241 RCV001251506 RCV001254692
Monogenic hearing loss	Pathogenic	rs763575837	RCV006254280
Neoplasm	Likely pathogenic; Pathogenic	rs2131501111, rs763236375	RCV004671616 RCV005232920
See cases	Pathogenic	rs2491459864	RCV003156182
Stage 5 chronic kidney disease	Pathogenic	rs112417755	RCV000494924

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
B-cell childhood acute lymphoblastic leukemia	Benign	rs3824662, rs3781093	RCV005401852 RCV005402711
Dominant congenital non-syndromic sensorineural hearing loss	Conflicting classifications of pathogenicity	rs1588383622	RCV001004795
Neurodevelopmental disorder	Uncertain significance	rs1832975214	RCV001374962
Ovarian neoplasm	not provided	rs104886016	RCV000119362

Show/Hide Text Mining Associations (264)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Abortion Spontaneous	Inhibit	37035756
Abscess	Associate	33159669
Acanthoma	Associate	26595821
Achalasia Addisonianism Alacrimia syndrome	Stimulate	37980558
ACTH Secreting Pituitary Adenoma	Associate	30390035
Addison Disease	Associate	24614117
Adenocarcinoma	Associate	28102292, 28693610, 31222589, 33762601
Adenocarcinoma Clear Cell	Associate	36320040
Adenocarcinoma Mucinous	Inhibit	24504018
Adenocarcinoma Mucinous	Associate	35405716
Adenocarcinoma of Lung	Inhibit	31909418
Adenoma	Stimulate	26595821, 36320040
Adenoma	Associate	37598154
Adenomatous Polyposis Coli	Associate	34623039
Alopecia Areata	Inhibit	26551570
Anemia Aplastic	Associate	17654061, 37980558
Angina Unstable	Associate	35437049
Arthritis	Associate	31238969
Arthritis Juvenile	Associate	31238969
Arthritis Rheumatoid	Associate	32831971
Asthma	Associate	28598986, 30552067, 36634709, 38346176
Asthma	Inhibit	28756630
Barakat syndrome	Associate	11389161, 21157112, 21242646, 23435732, 25510779, 26216189, 26268891, 26514990, 26731259, 26777049, 26800885, 28303854, 28566604, 29073906, 30218523 View all (5 more)
Biliary Atresia	Associate	26800885
Bohring syndrome	Associate	30613307
Bone Diseases	Associate	33307492
Breast Carcinoma In Situ	Associate	35477749
Breast Diseases	Associate	33462316, 34261476
Breast Neoplasms	Associate	17078870, 19082709, 19084267, 19405945, 19549328, 19638208, 20068169, 20103682, 20130088, 20132413, 20173733, 20501593, 21078439, 21329183, 21878914 View all (104 more)
Breast Neoplasms	Inhibit	19435916, 24448324, 27654269, 31685800
Breast Neoplasms	Stimulate	24887547, 30872657, 32687248
Breast Neoplasms Male	Associate	24194916, 26960396, 29116378, 31340200, 33964913, 38369186
Cakut	Associate	24429398
Calcium Metabolism Disorders	Associate	25165186
Carcinogenesis	Inhibit	12057898, 23577196
Carcinogenesis	Associate	25410484, 37667882
Carcinoma	Associate	26595821
Carcinoma Adenoid Cystic	Associate	31222589
Carcinoma Basal Cell	Associate	24145643, 25855136, 26595821, 28470571
Carcinoma Ductal	Associate	23375642
Carcinoma Ductal Breast	Associate	24145643
Carcinoma Hepatocellular	Associate	25552913, 27458175, 27528231, 31419443, 31871924, 35349565
Carcinoma in Situ	Stimulate	21078439
Carcinoma in Situ	Associate	28693610, 29654370, 33650041
Carcinoma Intraductal Noninfiltrating	Stimulate	24596378
Carcinoma Intraductal Noninfiltrating	Associate	26249178, 33795819, 38523186
Carcinoma Lobular	Associate	26451490, 27642214, 35477749
Carcinoma Merkel Cell	Associate	26595821
Carcinoma Neuroendocrine	Associate	35590107
Carcinoma Non Small Cell Lung	Associate	21507199, 27893417, 40199139
Carcinoma Renal Cell	Inhibit	18769122, 31636361, 36961416
Carcinoma Renal Cell	Associate	20208565, 20502531, 24549248, 27031776, 33501493, 35980471, 39258829
Carcinoma Renal Cell	Stimulate	24145643
Carcinoma Signet Ring Cell	Inhibit	24504018
Carcinoma Signet Ring Cell	Associate	29317235, 36779496, 39316894
Carcinoma Squamous Cell	Inhibit	12057898, 36323682
Carcinoma Squamous Cell	Associate	23106579, 26297502, 34301206
Carcinoma Transitional Cell	Associate	34784541
Cataract congenital with microcornea or slight microphthalmia	Associate	29073906
Choriocarcinoma	Associate	25188865
Churg Strauss Syndrome	Associate	20729468
Clear cell metastatic renal cell carcinoma	Associate	23375642, 24145643, 24711443
Colitis Ulcerative	Associate	22467146, 25526479
Collagenosis Familial Reactive Perforating	Associate	37638036
Colorectal Neoplasms	Associate	24743840, 28675510, 30658502, 37939965
Common Variable Immunodeficiency	Associate	32575504
COVID 19	Associate	33092653, 33923155, 36889300
Critical Illness	Associate	36889300
Crohn Disease	Associate	22467146
Deafness	Associate	26731259, 37600721
Death	Associate	21078439
Dental Caries	Associate	24192446
Depressive Disorder Major	Associate	31431611
Dermatitis Atopic	Stimulate	15008986
Dermatitis Atopic	Associate	18410415
Dermatitis Atopic	Inhibit	28928464
Dermatomyositis	Associate	27803134
Diabetes Mellitus Type 1	Inhibit	17244154
Diabetes Mellitus Type 1	Associate	35966054, 35986039
Diabetes Mellitus Type 2	Associate	30044774
Diabetic Foot	Associate	35909542
Diffuse Intrinsic Pontine Glioma	Associate	22747092
DiGeorge Syndrome	Associate	21242646
Disease	Associate	15247173, 24549248, 25165186, 32894760
Dizziness	Associate	24622013
Drug Hypersensitivity	Associate	18037162, 19436703, 36990085
Eczema	Associate	18410415, 28598986
Endocrine System Diseases	Associate	36518248
Endodermal Sinus Tumor	Associate	24145643, 31375771
Endometrial Neoplasms	Associate	35533253
Eosinophilic Esophagitis	Associate	29374572
Epidermolysis bullosa with pyloric atresia	Associate	32833315
Esophageal Achalasia	Associate	39907396
Esophageal Neoplasms	Stimulate	25144454
Esthesioneuroblastoma Olfactory	Associate	35522392
Familial cylindromatosis	Associate	26595821
Female Urogenital Diseases	Associate	21157112
Fetal Growth Retardation	Associate	35090410
Fibroadenoma	Associate	19383306
Fibrocystic Breast Disease	Associate	33382535
Fractures Bone	Inhibit	35401881
Gastroesophageal Reflux	Associate	29374572
Gaucher like disease	Associate	24477928
Genetic Diseases Inborn	Associate	27283966
Glioblastoma	Associate	28614770, 31075138, 40333895
Glioma	Associate	29617666
Glomerulonephritis	Associate	28566604
Glomerulonephritis Membranoproliferative	Associate	28566604
Graves Disease	Associate	22014209
Hashimoto Disease	Stimulate	28690889
Hearing Loss	Associate	24622013, 28303854, 29073906
Hearing Loss Sensorineural	Associate	21157112, 24622013, 26216189, 26514990, 26800885, 28303854, 29073906, 29986705
Hematologic Diseases	Associate	15286007
Hematologic Neoplasms	Associate	17654061
Hemoglobin SC Disease	Associate	33225648
Hepatitis B	Stimulate	26510790
Hereditary Angioedema Type III	Associate	19423651
Hereditary Breast and Ovarian Cancer Syndrome	Associate	20173733, 23604756, 38052269
Hereditary Breast and Ovarian Cancer Syndrome	Stimulate	24887547
Hereditary leiomyomatosis and renal cell cancer	Associate	12588891, 15632006, 20660789
Hidrocystoma	Associate	26595821
HIV Infections	Associate	35429609
Hodgkin Disease	Associate	12588891, 15632006, 17158640, 20660789, 21037568, 26473286, 35977101, 40302096
Hypercalciuria	Associate	32155322
Hypercalciuric Hypocalcemia Familial	Associate	23435732
Hyperglycemia	Stimulate	25894202
Hyperphagia	Associate	31431611
Hypersensitivity Immediate	Associate	28928464
Hypocalcemia	Associate	28303854
Hypoparathyroidism	Associate	21157112, 21242646, 26216189, 26731259, 26800885, 31433868, 31660939, 37600721
Ichthyosis X Linked	Associate	26731259
Ige Responsiveness Atopic	Associate	18037162
Immune System Diseases	Associate	21289214
Inflammation	Associate	15286007, 18037162, 21397857, 28928464, 31326962, 31431611, 32938228, 40585280
Inflammation	Inhibit	23395819
Inflammatory Bowel Diseases	Associate	30537794
Inflammatory Breast Neoplasms	Associate	31854063
Kidney Diseases	Associate	21157112, 28566604, 33092653, 37908345
Kidney Neoplasms	Inhibit	31636361
Kidney Neoplasms	Associate	36816543
Leprosy Multibacillary	Associate	27764137
Leukemia	Associate	23359050, 28415601
Leukemia Biphenotypic Acute	Associate	20484083
Leukemia Lymphocytic Chronic B Cell	Associate	36567979
Leukemia Lymphoma Adult T Cell	Associate	10212281, 33426772
Leukemia Myeloid Acute	Associate	37885041
Lichen Planus Oral	Associate	28278185
Lower Urinary Tract Symptoms	Associate	28656603
Lung Neoplasms	Associate	22797725, 23106579, 35993027, 37667882
Lupus Erythematosus Systemic	Stimulate	18641361, 24683191
Lupus Erythematosus Systemic	Associate	24886807, 29161463, 33763079
Lymphatic Metastasis	Stimulate	31871924
Lymphatic Metastasis	Associate	34057115, 36152841
Lymphoma	Associate	17272506, 27589565
Lymphoma	Inhibit	23372669
Lymphoma B Cell	Associate	31831043
Lymphoma Large Cell Anaplastic	Associate	22899583
Lymphoma Non Hodgkin	Associate	30059451
Lymphoma T Cell	Associate	17272506, 27780854, 36329027, 36567979
Lymphoma T Cell Cutaneous	Associate	16403914, 27345620, 28842936, 38165708
Lymphoma T Cell Peripheral	Associate	24497534, 24632715, 27589565, 28842936, 30782609, 31562134, 35839444
Lymphoproliferative Disorders	Associate	31558678
Mammary Analogue Secretory Carcinoma	Associate	23604756
Melanoma	Associate	30728070, 34301206
Meningioma	Associate	32716568
Mesothelioma	Associate	24145643, 33501493
Mesothelioma Malignant	Associate	33501493
Mucocutaneous Lymph Node Syndrome	Inhibit	15270865
Mullerian aplasia	Associate	35361250
Muscle Neoplasms	Associate	27803134
Mycosis Fungoides	Associate	27345620, 35642346
Myocardial Infarction	Associate	37798364
Nasal Polyps	Associate	19639723, 23063330, 27166273, 31326962
Neoplasm Metastasis	Inhibit	21892208, 23577196, 24205108, 24448324
Neoplasm Metastasis	Associate	23375642, 24549248, 29116378, 30246500, 31636361, 31871924, 32538432, 37077069, 37303939
Neoplasm Metastasis	Stimulate	29609951
Neoplasms	Associate	17078870, 19798410, 20053773, 20103682, 20208565, 20501593, 21059207, 21059815, 21078439, 21329183, 21878914, 22767585, 23375642, 23435732, 23604756 View all (73 more)
Neoplasms	Inhibit	19082709, 24504018, 28614770, 29434343, 34680134, 40585280
Neoplasms	Stimulate	24887547
Neoplasms Adnexal and Skin Appendage	Associate	24145643
Neoplasms Cystic Mucinous and Serous	Associate	35405716
Neoplasms Glandular and Epithelial	Associate	26595821
Neoplasms Squamous Cell	Associate	36329027, 38165708
Neuroblastoma	Inhibit	19707195
Neuroblastoma	Associate	31819055, 31831790, 36130928, 36598365
Neuroectodermal Tumors Primitive	Associate	22747092
Neuroendocrine Tumors	Associate	30390035, 32668278
Non Muscle Invasive Bladder Neoplasms	Associate	31469885, 33538412, 33650041, 34697907, 34707176, 37389960
Non Muscle Invasive Bladder Neoplasms	Inhibit	36152841
Nose Diseases	Associate	19639723
Obesity	Associate	17030965, 29546532
Obesity	Inhibit	35401881
Osteoarthritis	Associate	35524376
Ovarian Neoplasms	Associate	31935430, 33921111, 34399777, 35405716, 35488350, 37303939
Paget Disease Extramammary	Associate	28693610
Paget's Disease Mammary	Associate	32114594
Pancreatic Neoplasms	Associate	19798410
Pancreatitis	Associate	24145643
Paraganglioma	Associate	23599157, 24145643, 32892244
Paraparesis Tropical Spastic	Stimulate	15572854
Parkinson Disease	Inhibit	37373190
Pelvic Inflammatory Disease	Associate	26595821, 31591497
Periapical Diseases	Associate	39972438
Periapical Granuloma	Associate	39972438
Periodontal Attachment Loss	Associate	35806269
Periodontal Diseases	Associate	35806269
Philadelphia Chromosome	Associate	24141364, 25468567
Pilomatrixoma	Associate	26595821
Pleural Effusion Malignant	Associate	26465236
Polycystic Ovary Syndrome	Associate	37334500
Pre Eclampsia	Associate	27999241, 32566660
Pre Eclampsia	Inhibit	28502089
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	24141364, 25468567, 28415601, 32894760, 33891562, 35115686
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	22237106, 23359050, 35385357, 37642051, 9819382
Progesterone Resistance	Associate	30691046
Progressive hearing loss stapes fixation	Associate	29073906
Prostatic Hyperplasia	Associate	28656603
Prostatic Neoplasms	Associate	18500686, 24185611
Psoriasis	Inhibit	28928464
Pulmonary Disease Chronic Obstructive	Associate	31320835, 34354706
Purpura Thrombocytopenic Idiopathic	Inhibit	31014934
Radicular Cyst	Associate	39972438
Reproductive Tract Infections	Stimulate	23555586
Rhinitis	Associate	18037162, 28598986
Rhinitis Allergic	Associate	18037162, 36149748
Salivary Duct Calculi	Associate	23604756
Salivary Gland Diseases	Associate	24145643
Salivary Gland Neoplasms	Associate	23604756
Sarcoma	Associate	27249072, 36005179, 39491746
Schizophrenia	Associate	37552420
Sebaceous Gland Neoplasms	Stimulate	26595821
Secretory breast carcinoma	Associate	32457407
Senior Loken Syndrome	Associate	24622013, 26514990, 26777049, 26800885, 28303854, 37600721
Sezary Syndrome	Associate	16403914, 22951729, 36400759
Sick Sinus Syndrome	Associate	24205108
Skin Diseases	Associate	15008986
Sleep Wake Disorders	Associate	37373190
Squamous Cell Carcinoma of Head and Neck	Associate	27036044, 36468944
Status Asthmaticus	Stimulate	11589343
Status Asthmaticus	Associate	22768198, 23395819, 25981191, 30013989, 36634709
Stomach Neoplasms	Associate	24338397, 24504018, 30365045
Stomach Neoplasms	Stimulate	24741632
Takayasu Arteritis	Associate	35126357
Tetralogy of Fallot	Associate	33159669
Tn Syndrome	Associate	29892290
Trichofolliculoma	Associate	26595821
Triple Negative Breast Neoplasms	Associate	21892208, 23375642, 23549873, 23577196, 25068292, 28470571, 32687248, 34972751, 36157217
Triple Negative Breast Neoplasms	Inhibit	36284362, 37077069
Trophoblastic Neoplasms	Associate	25188865
Tuberculosis Pleural	Inhibit	21829471
Tubular Sweat Gland Adenomas	Stimulate	26595821
Urethral Neoplasms	Associate	23106579, 23599157, 24711443, 27642214, 31348552, 33011748, 36152841, 40650155
Urethritis	Associate	37667882
Urinary Bladder Diseases	Stimulate	23599157
Urinary Bladder Diseases	Associate	33716284
Urinary Bladder Neoplasms	Associate	24124001, 27237631, 31469885, 32546765, 32929335, 33858483, 36152841, 36323682, 36997051, 37542643, 37667882, 38052269, 39979991
Urinary Bladder Neoplasms	Inhibit	24448324
Urinary Tract Infections	Stimulate	30484290
Uterine Cervical Dysplasia	Associate	29434343
Uterine Cervical Neoplasms	Inhibit	12057898
Uterine Cervical Neoplasms	Associate	18217980, 36768623
Vestibular Diseases	Associate	24622013
Waardenburg syndrome type 2	Associate	36038884
X Linked Combined Immunodeficiency Diseases	Associate	39979991

GATA3 (GATA binding protein 3)