LCE2B (late cornified envelope 2B)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
26239
Gene name Gene Name - the full gene name approved by the HGNC.
Late cornified envelope 2B
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
LCE2B
Synonyms (NCBI Gene) Gene synonyms aliases
LEP10, SPRL1B, XP5
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1q21.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene is one of the at least 20 genes expressed during epidermal differentiation and located on chromosomal band 1q21. This gene is involved in epidermal differentiation, and it is expressed at high levels in normal and psoriatic skin, but not in cult
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways
Show/Hide all(8)
miRTarBase ID miRNA Experiments Reference
MIRT2260100 hsa-miR-150 CLIP-seq
MIRT2260101 hsa-miR-1915 CLIP-seq
MIRT2260102 hsa-miR-3189-5p CLIP-seq
MIRT2260103 hsa-miR-4323 CLIP-seq
MIRT2260104 hsa-miR-4713-5p CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways
Show/Hide all(5)
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183
GO:0008544 Process Epidermis development IEA
GO:0008544 Process Epidermis development NAS 9344646
GO:0031424 Process Keratinization IEA
GO:0042802 Function Identical protein binding IPI 32296183
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways
MIM HGNC e!Ensembl
612610 16610 ENSG00000159455
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways
UniProt ID O14633
Protein name Late cornified envelope protein 2B (Late envelope protein 10) (Skin-specific protein Xp5) (Small proline-rich-like epidermal differentiation complex protein 1B)
Protein function Precursors of the cornified envelope of the stratum corneum.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF14672 LCE 54 → 110 Late cornified envelope Family
Tissue specificity TISSUE SPECIFICITY: Skin-specific. Expression was readily detected in adult trunk skin, adult arm skin, fetal skin, penal skin, vulva, esophagus and tongue. Not expressed in the cervix, rectum, lung, colon, or placenta. {ECO:0000269|PubMed:15854049, ECO:0
Sequence 
MSCQQNQQQCQPPPKCPPKCTPKCPPKCPPKCLPQCPAPCSPAVSSCCGPISGGCCGPSS
GGCCNSGAGGCCLSHHRPRLFHRRRHQSPDCCESEPSGGSGCCHSSGGCC
Sequence length 110
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways
  Reactome
    Formation of the cornified envelope
<