Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
26235
Gene name Gene Name - the full gene name approved by the HGNC.
F-box and leucine rich repeat protein 4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
FBXL4
Synonyms (NCBI Gene) Gene synonyms aliases
FBL4, FBL5, MTDPS13
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6q16.1-q16.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the F-box protein family, which are characterized by an approximately 40 amino acid motif, the F-box. F-box proteins constitute one subunit of modular E3 ubiquitin ligase complexes, called SCF complexes, which function in pho
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs200440128 G>A Pathogenic Coding sequence variant, stop gained, 5 prime UTR variant, non coding transcript variant
rs201889294 G>A,T Pathogenic Coding sequence variant, non coding transcript variant, synonymous variant, stop gained, genic downstream transcript variant
rs201989042 T>G Likely-pathogenic, pathogenic-likely-pathogenic Coding sequence variant, non coding transcript variant, missense variant, genic downstream transcript variant
rs368965675 C>A Pathogenic Splice acceptor variant
rs398123059 G>A Pathogenic Stop gained, non coding transcript variant, coding sequence variant, genic downstream transcript variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT619238 hsa-miR-4795-5p HITS-CLIP 23824327
MIRT619237 hsa-miR-4513 HITS-CLIP 23824327
MIRT619236 hsa-miR-6855-3p HITS-CLIP 23824327
MIRT619235 hsa-miR-6857-3p HITS-CLIP 23824327
MIRT619234 hsa-miR-5189-3p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000151 Component Ubiquitin ligase complex TAS 10531035
GO:0000422 Process Autophagy of mitochondrion IEA
GO:0000422 Process Autophagy of mitochondrion IEA
GO:0000422 Process Autophagy of mitochondrion IMP 32525278
GO:0000423 Process Mitophagy IMP 22505714
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
605654 13601 ENSG00000112234
Protein
UniProt ID Q9UKA2
Protein name F-box/LRR-repeat protein 4 (F-box and leucine-rich repeat protein 4) (F-box protein FBL4/FBL5)
Protein function Substrate-recognition component of the mitochondria-localized SCF-FBXL4 ubiquitin E3 ligase complex that plays a role in the restriction of mitophagy by controlling the degradation of BNIP3 and NIX mitophagy receptors (PubMed:36896912, PubMed:38
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00646 F-box 279 323 F-box domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in heart, kidney, liver, lung, pancreas, and placenta, but not in skeletal muscle. {ECO:0000269|PubMed:10531037}.
Sequence
MSPVFPMLTVLTMFYYICLRRRARTATRGEMMNTHRAIESNSQTSPLNAEVVQYAKEVVD
FSSHYGSENSMSYTMWNLAGVPNVFPSSGDFTQTAVFRTYGTWWDQCPSASLPFKRTPPN
FQSQDYVELTFEQQVYPTAVHVLETYHPGAVIRILACSANPYSPNPPAEVRWEILWSERP
TKVNASQARQFKPCIKQINFPTNLIRLEVNSSLLEYYTELDAVVLHGVKDKPVLSLKTSL
IDMNDIEDDAYAEKDGCGMDSLNKKFSSAVLGEGPNNGYFDKLPYELIQLILNHLTLPDL
CRLAQTCKLLSQHCCDPLQYIHL
NLQPYWAKLDDTSLEFLQSRCTLVQWLNLSWTGNRGF
ISVAGFSRFLKVCGSELVRLELSCSHFLNETCLEVISEMCPNLQALNLSSCDKLPPQAFN
HIAKLCSLKRLVLYRTKVEQTALLSILNFCSELQHLSLGSCVMIEDYDVIASMIGAKCKK
LRTLDLWRCKNITENGIAELASGCPLLEELDLGWCPTLQSSTGCFTRLAHQLPNLQKLFL
TANRSVCDTDIDELACNCTRLQQLDILGTRMVSPASLRKLLESCKDLSLLDVSFCSQIDN
RAVLELNASFPKVFIKKSFTQ
Sequence length 621
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Neddylation
Antigen processing: Ubiquitination & Proteasome degradation
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
leigh syndrome Leigh syndrome rs398123061, rs773850151, rs201889294 N/A
Mitochondrial DNA Depletion Syndrome Mitochondrial DNA depletion syndrome 13 rs761974928, rs1554215766, rs750973870, rs398123061, rs1257765682, rs761215749, rs751656896, rs1554218789, rs1394080480, rs1554222122, rs747618415, rs754142863, rs1554221189, rs398123062, rs1554222130
View all (37 more)
N/A
mitochondrial dna depletion syndrome Mitochondrial DNA depletion syndrome rs1582402094, rs201889294 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Insomnia Insomnia N/A N/A GWAS
Mental Depression Major depressive disorder N/A N/A GWAS
Moyamoya Disease Moyamoya angiopathy N/A N/A ClinVar
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Acidosis Associate 32779419
Acidosis Lactic Associate 23993193, 25868664, 31442532, 32779419
Atrophy Associate 23993194
Brain Diseases Associate 23993193, 25868664, 32779419
Cardiomegaly Associate 31442532
Cardiomyopathies Associate 31442532
Developmental Disabilities Associate 32779419
Facial Dysmorphism with Multiple Malformations Associate 25868664
Feeding and Eating Disorders Associate 32779419
Hand Foot and Mouth Disease Associate 32634583