Gene Gene information from NCBI Gene database.
Entrez ID 26224
Gene name F-box and leucine rich repeat protein 3
Gene symbol FBXL3
Synonyms (NCBI Gene)
FBL3FBL3AFBXL3AIDDSFAS
Chromosome 13
Chromosome location 13q22.3
Summary This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), w
SNPs SNP information provided by dbSNP.
3
SNP ID Visualize variation Clinical significance Consequence
rs374431043 G>A,C,T Pathogenic Missense variant, 5 prime UTR variant, synonymous variant, stop gained, coding sequence variant
rs764008859 A>- Pathogenic Frameshift variant, coding sequence variant, intron variant
rs1566225872 A>G Pathogenic Coding sequence variant, intron variant, missense variant
miRNA miRNA information provided by mirtarbase database.
300
miRTarBase ID miRNA Experiments Reference
MIRT019641 hsa-miR-340-5p Sequencing 20371350
MIRT021110 hsa-miR-186-5p Sequencing 20371350
MIRT028091 hsa-miR-93-5p Sequencing 20371350
MIRT703633 hsa-miR-4797-5p HITS-CLIP 23313552
MIRT703632 hsa-miR-5586-3p HITS-CLIP 23313552
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
29
GO ID Ontology Definition Evidence Reference
GO:0000151 Component Ubiquitin ligase complex NAS 10531035
GO:0004842 Function Ubiquitin-protein transferase activity IDA 17463251
GO:0004842 Function Ubiquitin-protein transferase activity IEA
GO:0004842 Function Ubiquitin-protein transferase activity NAS 10531035
GO:0005515 Function Protein binding IPI 17463251, 23503662, 32296183
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
605653 13599 ENSG00000005812
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9UKT7
Protein name F-box/LRR-repeat protein 3 (F-box and leucine-rich repeat protein 3A) (F-box/LRR-repeat protein 3A)
Protein function Substrate-recognition component of the SCF(FBXL3) E3 ubiquitin ligase complex involved in circadian rhythm function. Plays a key role in the maintenance of both the speed and the robustness of the circadian clock oscillation (PubMed:17463251, Pu
PDB 4I6J
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF12937 F-box-like 41 81 F-box-like Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:10531035}.
Sequence
MKRGGRDSDRNSSEEGTAEKSKKLRTTNEHSQTCDWGNLLQDIILQVFKYLPLLDRAHAS
QVCRNWNQVFHMPDLWRCFEF
ELNQPATSYLKATHPELIKQIIKRHSNHLQYVSFKVDSS
KESAEAACDILSQLVNCSLKTLGLISTARPSFMDLPKSHFISALTVVFVNSKSLSSLKID
DTPVDDPSLKVLVANNSDTLKLLKMSSCPHVSPAGILCVADQCHGLRELALNYHLLSDEL
LLALSSEKHVRLEHLRIDVVSENPGQTHFHTIQKSSWDAFIRHSPKVNLVMYFFLYEEEF
DPFFRYEIPATHLYFGRSVSKDVLGRVGMTCPRLVELVVCANGLRPLDEELIRIAERCKN
LSAIGLGECEVSCSAFVEFVKMCGGRLSQLSIMEEVLIPDQKYSLEQIHWEVSKHLGRVW
FPDMMPTW
Sequence length 428
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Circadian rhythm   Neddylation
Antigen processing: Ubiquitination & Proteasome degradation
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
9
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Intellectual disability, short stature, facial anomalies, and joint dislocations Pathogenic rs2154035941, rs374431043, rs764008859, rs1566225872 RCV001806231
RCV000767371
RCV000767372
RCV000767373
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
FBXL3-related disorder Likely benign; Benign rs757276072, rs76487761 RCV003959240
RCV003932321
RCV003921937
Hepatocellular carcinoma Benign rs599115 RCV005922330
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Breast Neoplasms Associate 39193850
Colorectal Neoplasms Associate 21209843
COVID 19 Associate 36913345
Developmental Disabilities Associate 30481285
Facial Dysmorphism with Multiple Malformations Associate 30481285
Growth Disorders Associate 30481285
Intellectual Disability Associate 30481285