FBXL21P (F-box and leucine rich repeat protein 21, pseudogene)

Gene Gene information from NCBI Gene database.
Gene Gene ontology Other IDs Protein
Entrez ID 26223
Gene name F-box and leucine rich repeat protein 21, pseudogene
Gene symbol FBXL21P
Synonyms (NCBI Gene)
FBL3BFBXL21FBXL3BFBXL3PFbl21
Chromosome 5
Chromosome location 5q31.1
Summary This locus represents a transcribed pseudogene that is related to genes encoding members of the F-box family of proteins. [provided by RefSeq, Nov 2017]
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
19
Gene Gene ontology Other IDs Protein
Show/Hide all (19)
GO ID Ontology Definition Evidence Reference
GO:0000151 Component Ubiquitin ligase complex NAS 10531035
GO:0004842 Function Ubiquitin-protein transferase activity NAS 10531035
GO:0005515 Function Protein binding IPI 28514442, 33961781
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene Gene ontology Other IDs Protein
MIM HGNC e!Ensembl
609087 13600 HGNC
Protein Protein information from UniProt database.
Gene Gene ontology Other IDs Protein
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9UKT6
Protein name Putative F-box/LRR-repeat protein 21 (F-box and leucine-rich repeat protein 21) (F-box and leucine-rich repeat protein 3B) (F-box/LRR-repeat protein 3B)
Protein function Substrate-recognition component of the SCF(FBXL21) E3 ubiquitin ligase complex involved in circadian rhythm function. Plays a key role in the maintenance of both the speed and the robustness of the circadian clock oscillation. The SCF(FBXL21) co
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00646 F-box 40 → 87 F-box domain Domain
Sequence 
MKRNSLSVENKIVQLSGAAKQPKVGFYSSLNQTHTHTVLLDWGSLPHHVVLQIFQYLPLL
DRACASSVCRRWNEVFHISDLWRKFEFELNQSATSSFKSTHPDLIQQIIKKHFAHLQYVS
FKVDSSAESAEAACDILSQLVNCSIQTLGLISTAKPSFMNVSESHFVSALTVVFINSKSL
SSIKIEDTPVDDPSLKILVANNSDTLRLPKMSSCPHVSSDGILCVADRCQGLRELALNYY
ILTDELFLALSSETHVNLEHLRIDVVSENPGQIKFHAVKKHSWDALIKHSPRVNVVMHFF
LYEEEFETFFKEETPVTHLYFGRSVSKVVLGRVGLNCPRLIELVVCANDLQPLDNELICI
AEHCTNLTALGLSKCEVSCSAFIRFVRLCERRLTQLSVMEEVLIPDEDYSLDEIHTEVSK
YLGRVWFPDVMPLW
Sequence length 434
Interactions View interactions