Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	2621
Gene name Gene Name - the full gene name approved by the HGNC.	Growth arrest specific 6
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	GAS6
Synonyms (NCBI Gene) Gene synonyms aliases	AXLLG, AXSF
Chromosome Chromosome number	13
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	13q34
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a gamma-carboxyglutamic acid (Gla)-containing protein thought to be involved in the stimulation of cell proliferation. This gene is frequently overexpressed in many cancers and has been implicated as an adverse prognostic marker. Elevate

Show/Hide all(14)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022472	hsa-miR-124-3p	Microarray	18668037
MIRT1012277	hsa-miR-1193	CLIP-seq
MIRT1012278	hsa-miR-3125	CLIP-seq
MIRT1012279	hsa-miR-3916	CLIP-seq
MIRT1012277	hsa-miR-1193	CLIP-seq
MIRT1549170	hsa-miR-190	CLIP-seq
MIRT1549171	hsa-miR-190b	CLIP-seq
MIRT1012278	hsa-miR-3125	CLIP-seq
MIRT1012279	hsa-miR-3916	CLIP-seq
MIRT1549172	hsa-miR-4267	CLIP-seq
MIRT1549173	hsa-miR-4310	CLIP-seq
MIRT1549174	hsa-miR-4438	CLIP-seq
MIRT1549175	hsa-miR-4699-3p	CLIP-seq
MIRT1549176	hsa-miR-5095	CLIP-seq

Show/Hide all(99)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001764	Process	Neuron migration	IEA
GO:0001786	Function	Phosphatidylserine binding	IDA	21501828
GO:0001934	Process	Positive regulation of protein phosphorylation	IDA	7854420
GO:0001934	Process	Positive regulation of protein phosphorylation	ISS
GO:0001961	Process	Positive regulation of cytokine-mediated signaling pathway	IMP	18840707
GO:0003104	Process	Positive regulation of glomerular filtration	IEA
GO:0003104	Process	Positive regulation of glomerular filtration	ISS
GO:0005102	Function	Signaling receptor binding	IDA	16359517
GO:0005102	Function	Signaling receptor binding	IPI	7854420
GO:0005509	Function	Calcium ion binding	IEA
GO:0005515	Function	Protein binding	IPI	16362042, 18760998, 20088931, 20103767
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IDA	8336730, 18395422, 19922767, 20088931
GO:0005615	Component	Extracellular space	IEA
GO:0005737	Component	Cytoplasm	IDA	18395422
GO:0005788	Component	Endoplasmic reticulum lumen	TAS
GO:0005796	Component	Golgi lumen	IEA
GO:0005796	Component	Golgi lumen	TAS
GO:0006468	Process	Protein phosphorylation	IDA	16359517
GO:0006909	Process	Phagocytosis	IDA	21501828
GO:0006915	Process	Apoptotic process	IEA
GO:0007165	Process	Signal transduction	IDA	7854420, 18680538
GO:0007165	Process	Signal transduction	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	IDA	20103767
GO:0007166	Process	Cell surface receptor signaling pathway	IEA
GO:0007167	Process	Enzyme-linked receptor protein signaling pathway	IEA
GO:0007596	Process	Blood coagulation	IEA
GO:0009267	Process	Cellular response to starvation	IEA
GO:0010628	Process	Positive regulation of gene expression	IDA	19657094
GO:0010804	Process	Negative regulation of tumor necrosis factor-mediated signaling pathway	IDA	19657094
GO:0016477	Process	Cell migration	IEA
GO:0019064	Process	Fusion of virus membrane with host plasma membrane	IDA	21501828
GO:0019079	Process	Viral genome replication	IDA	21501828
GO:0030154	Process	Cell differentiation	IEA
GO:0030674	Function	Protein-macromolecule adaptor activity	IDA	21501828
GO:0030971	Function	Receptor tyrosine kinase binding	IPI	7634325
GO:0031093	Component	Platelet alpha granule lumen	TAS
GO:0031100	Process	Animal organ regeneration	IEA
GO:0031589	Process	Cell-substrate adhesion	IEA
GO:0031669	Process	Cellular response to nutrient levels	IEA
GO:0032008	Process	Positive regulation of TOR signaling	IEA
GO:0032008	Process	Positive regulation of TOR signaling	ISS
GO:0032148	Process	Activation of protein kinase B activity	ISS
GO:0032689	Process	Negative regulation of type II interferon production	IDA	18840707
GO:0032692	Process	Negative regulation of interleukin-1 production	IDA	20103767
GO:0032715	Process	Negative regulation of interleukin-6 production	IDA	19657094, 20103767
GO:0032720	Process	Negative regulation of tumor necrosis factor production	IDA	19657094, 20103767
GO:0032825	Process	Positive regulation of natural killer cell differentiation	IDA	18840707
GO:0033028	Process	Myeloid cell apoptotic process	IEA
GO:0033033	Process	Negative regulation of myeloid cell apoptotic process	IEA
GO:0035457	Process	Cellular response to interferon-alpha	IDA	19657094
GO:0035754	Process	B cell chemotaxis	IDA	19922767
GO:0043027	Function	Cysteine-type endopeptidase inhibitor activity involved in apoptotic process	IDA	16723520
GO:0043066	Process	Negative regulation of apoptotic process	IDA	19922767
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043277	Process	Apoptotic cell clearance	IDA	21501828
GO:0043277	Process	Apoptotic cell clearance	IEA
GO:0043277	Process	Apoptotic cell clearance	IEA
GO:0044346	Process	Fibroblast apoptotic process	IEA
GO:0045860	Process	Positive regulation of protein kinase activity	IDA	7854420
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	18680538
GO:0046718	Process	Symbiont entry into host cell	IDA	21501828
GO:0046813	Process	Receptor-mediated virion attachment to host cell	IDA	21501828
GO:0046827	Process	Positive regulation of protein export from nucleus	IDA	18680538
GO:0046872	Function	Metal ion binding	IEA
GO:0048018	Function	Receptor ligand activity	IBA
GO:0048018	Function	Receptor ligand activity	IDA	15184064, 20103767
GO:0048018	Function	Receptor ligand activity	IEA
GO:0048146	Process	Positive regulation of fibroblast proliferation	IDA	15184064
GO:0048146	Process	Positive regulation of fibroblast proliferation	IDA	7854420
GO:0050766	Process	Positive regulation of phagocytosis	IDA	18395422
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	16359517, 16723520, 18680538, 20103767
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0070168	Process	Negative regulation of biomineral tissue development	IDA	20048160
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IDA	15184064
GO:0070588	Process	Calcium ion transmembrane transport	IDA	18395422
GO:0071307	Process	Cellular response to vitamin K	IDA	16359517
GO:0071333	Process	Cellular response to glucose stimulus	IEA
GO:0071333	Process	Cellular response to glucose stimulus	ISS
GO:0071363	Process	Cellular response to growth factor stimulus	IEA
GO:0071466	Process	Cellular response to xenobiotic stimulus	IDA	16359517
GO:0071466	Process	Cellular response to xenobiotic stimulus	IEA
GO:0072659	Process	Protein localization to plasma membrane	IDA	16359517
GO:0085029	Process	Extracellular matrix assembly	IEA
GO:0085029	Process	Extracellular matrix assembly	ISS
GO:0097028	Process	Dendritic cell differentiation	IEP	19657094
GO:0097241	Process	Hematopoietic stem cell migration to bone marrow	IDA	19922767
GO:1900142	Process	Negative regulation of oligodendrocyte apoptotic process	IDA	16723520
GO:2000270	Process	Negative regulation of fibroblast apoptotic process	IDA	16359517
GO:2000270	Process	Negative regulation of fibroblast apoptotic process	IEA
GO:2000270	Process	Negative regulation of fibroblast apoptotic process	IEA
GO:2000352	Process	Negative regulation of endothelial cell apoptotic process	IDA	16359517, 18680538, 18760998
GO:2000510	Process	Positive regulation of dendritic cell chemotaxis	IDA	19657094
GO:2000533	Process	Negative regulation of renal albumin absorption	IEA
GO:2000533	Process	Negative regulation of renal albumin absorption	ISS
GO:2000669	Process	Negative regulation of dendritic cell apoptotic process	IDA	19657094

MIM	HGNC	e!Ensembl
600441	4168	ENSG00000183087

Protein

UniProt ID

Q14393

Protein name

Growth arrest-specific protein 6 (GAS-6) (AXL receptor tyrosine kinase ligand)

Protein function

Ligand for tyrosine-protein kinase receptors AXL, TYRO3 and MER whose signaling is implicated in cell growth and survival, cell adhesion and cell migration. GAS6/AXL signaling plays a role in various processes such as endothelial cell survival d

PDB

1H30 , 2C5D , 4RA0 , 5VXZ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00594	Gla	53 → 93	Vitamin K-dependent carboxylation/gamma-carboxyglutamic (GLA) domain	Domain
PF12661	hEGF	129 → 148	Human growth factor-like EGF	Domain
PF12662	cEGF	177 → 200	Complement Clr-like EGF-like	Domain
PF12661	hEGF	207 → 227	Human growth factor-like EGF	Domain
PF07645	EGF_CA	238 → 277	Calcium-binding EGF domain	Domain
PF00054	Laminin_G_1	325 → 454	Laminin G domain	Domain
PF02210	Laminin_G_2	513 → 651	Laminin G domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Plasma. Isoform 1 and isoform 2 are widely expressed, isoform 1 being expressed at higher levels than isoform 2 in most tissues. Isoform 2 is the predominant form in spleen. {ECO:0000269|PubMed:8336730, ECO:0000269|PubMed:9326368}.

Sequence

MAPSLSPGPAALRRAPQLLLLLLAAECALAALLPAREATQFLRPRQRRAFQVFEEAKQGH
LERECVEELCSREEAREVFENDPETDYFYPRYLDCINKYGSPYTKNSGFATCVQNLPDQC
TPNPCDRKGTQACQDLMGNFFCLCKAGWGGRLCDKDVNECSQENGGCLQICHNKPGSFHC
SCHSGFELSSDGRTCQDIDECADSEACGEARCKNLPGSYSCLCDEGFAYSSQEKACRDVD
ECLQGRCEQVCVNSPGSYTCHCDGRGGLKLSQDMDTCEDILPCVPFSVAKSVKSLYLGRM
FSGTPVIRLRFKRLQPTRLVAEFDFRTFDPEGILLFAGGHQDSTWIVLALRAGRLELQLR
YNGVGRVTSSGPVINHGMWQTISVEELARNLVIKVNRDAVMKIAVAGDLFQPERGLYHLN
LTVGGIPFHEKDLVQPINPRLDGCMRSWNWLNGEDTTIQETVKVNTRMQCFSVTERGSFY
PGSGFAFYSLDYMRTPLDVGTESTWEVEVVAHIRPAADTGVLFALWAPDLRAVPLSVALV
DYHSTKKLKKQLVVLAVEHTALALMEIKVCDGQEHVVTVSLRDGEATLEVDGTRGQSEVS
AAQLQERLAVLERHLRSPVLTFAGGLPDVPVTSAPVTAFYRGCMTLEVNRRLLDLDEAAY
KHSDITAHSCPPVEPAAA

Sequence length

678

Interactions

View interactions

	KEGG		Reactome
	EGFR tyrosine kinase inhibitor resistance Efferocytosis		Platelet degranulation Transport of gamma-carboxylated protein precursors from the endoplasmic reticulum to the Golgi apparatus Removal of aminoterminal propeptides from gamma-carboxylated proteins Cell surface interactions at the vascular wall Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs) Post-translational protein phosphorylation

Show/Hide Unknown Diseases (2)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Diabetes	Triglyceride levels in non-type 2 diabetes	N/A	N/A	GWAS
Oligodendroglioma	Oligodendroglioma	N/A	N/A	GWAS

Show/Hide Text Mining Associations (97)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Acute Lung Injury	Associate	29176262
Adenocarcinoma	Inhibit	33120770
Adenocarcinoma of Lung	Associate	23242819, 33120770, 33987935
Arthritis Rheumatoid	Associate	10233855, 38283352
Ascites	Associate	26356564
Asthma	Associate	19187333
Atherosclerosis	Associate	10526166, 22907951, 32462812
Atherosclerosis	Inhibit	23372645
Atrial Fibrillation	Associate	36894947
Behcet Syndrome	Associate	27222359
Bjornstad syndrome	Associate	31028135
Blood Platelet Disorders	Associate	19696043
Brain Neoplasms	Associate	28551766
Breast Neoplasms	Associate	18283315
Breast Neoplasms	Stimulate	33223203
Calcinosis	Associate	16556867, 26924277
Carcinoma Non Small Cell Lung	Associate	28551766, 32909687
Carcinoma Non Small Cell Lung	Stimulate	38342232
Carcinoma Pancreatic Ductal	Associate	20922806, 32909687
Carcinoma Renal Cell	Associate	19567592, 19888345, 25187556, 34611307, 35760058, 37348477
Carcinoma Small Cell	Associate	29734873
Cardiomegaly	Associate	36635690
Cardiomyopathy Dilated	Associate	39762897
Cardiovascular Diseases	Associate	26284522, 30423812
Cardiovascular Diseases	Stimulate	36635690
Carotid Artery Diseases	Associate	35680486
Colorectal Neoplasms	Associate	34344319, 38521199
Coronary Disease	Associate	26924277
Diabetes Mellitus	Inhibit	28513288
Diabetes Mellitus Type 2	Associate	26284522, 28399188, 35680486
Diabetic Angiopathies	Associate	24572151
Diabetic Nephropathies	Inhibit	28513288
Drug Related Side Effects and Adverse Reactions	Associate	10233855
Endometrial Neoplasms	Associate	12796028, 35588308
Endometrial Neoplasms	Inhibit	36965901
Esophageal Neoplasms	Associate	31110076, 32432570
Fibrosis	Associate	36635690
Glioblastoma	Associate	12218057, 26863628, 27783662
Glomerulonephritis	Associate	23826128
Glomerulonephritis IGA	Associate	23826128
Glucosephosphate Dehydrogenase Deficiency	Stimulate	12796028
Graft vs Host Disease	Stimulate	31300420
Heart Diseases	Associate	24572151, 31524235
Heart Failure	Associate	36635690
Heart Septal Defects Ventricular	Associate	30423812
Hemorrhage	Associate	30570809
Hepatitis Autoimmune	Associate	37108648
Hypoxia	Associate	22516347
Idiopathic Pulmonary Fibrosis	Stimulate	29634284
Inflammation	Associate	22907951, 23372645, 26284522, 26445266, 30713533, 32462812, 34734092, 36635690
Inflammation	Inhibit	25752901
Insulin Resistance	Associate	26284522
Kidney Diseases	Associate	22907951
Kidney Failure Chronic	Stimulate	22907951
Leiomyosarcoma	Associate	29024938
Leukemia	Associate	19922767, 34103328
Leukemia Myeloid Acute	Associate	23474756, 24326683, 31028135
Liposarcoma	Associate	26573603
Lung Diseases Interstitial	Associate	32454903
Lupus Erythematosus Systemic	Associate	23497733
Lymphatic Metastasis	Associate	26207647
Macular Degeneration	Associate	23209669
Melanoma	Associate	32269179
Metabolic Syndrome	Associate	25752901
Multiple Myeloma	Associate	28154173, 32298237, 35967396
Multiple Sclerosis	Associate	19541935, 23781120
Myocardial Infarction	Associate	36856591
Myopathies Structural Congenital	Associate	27222359
Neoplasm Metastasis	Associate	22516347, 25187556, 29024938, 34611307
Neoplasms	Associate	12796028, 18283315, 19567592, 23242819, 25187556, 26356564, 28675785, 28923840, 31419057, 32269179, 32432570, 32664510, 33223203, 34611307, 34782372 View all (6 more)
Neoplasms	Inhibit	28771526
Neoplasms	Stimulate	34286546
Nephritis	Associate	23826128
Obesity	Associate	26284522, 28399188
Oculocutaneous albinism type 2	Stimulate	31300420
Osteoarthritis	Associate	10233855
Osteosarcoma	Associate	32269179, 39174890
Ovarian Neoplasms	Associate	33921111
Pancreatic Neoplasms	Associate	29157747, 31959629
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	19922767
Prostatic Neoplasms	Associate	22516347, 28084441, 28771526, 35075375, 35595103
Psoriasis	Associate	25752901
Pulmonary Fibrosis	Associate	29634284
Renal Insufficiency Chronic	Stimulate	22907951
Scleroderma Systemic	Associate	32454903
Sepsis	Associate	31524235
Sjogren's Syndrome	Inhibit	26445266
Smoke Inhalation Injury	Associate	23372645
Squamous Cell Carcinoma of Head and Neck	Stimulate	26207647
Stroke	Associate	36894947, 40596960
Thrombosis	Associate	22907951
Thrombotic Microangiopathies	Associate	31300420
Thyroid Cancer Papillary	Associate	37733241
Triple Negative Breast Neoplasms	Associate	27145494
Urinary Bladder Neoplasms	Associate	32269179, 34286546, 37313656
Vascular Diseases	Associate	24236135, 26924277, 31300420
Venous Thromboembolism	Associate	30570809

GAS6 (growth arrest specific 6)