Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
26206
Gene name Gene Name - the full gene name approved by the HGNC.
Sperm associated antigen 8
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SPAG8
Synonyms (NCBI Gene) Gene synonyms aliases
BS-84, CILD28, CT142, HSD-1, SMP1, SPAG3, hSMP-1
Chromosome Chromosome number
9
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
9p13.3
Summary Summary of gene provided in NCBI Entrez Gene.
The correlation of anti-sperm antibodies with cases of unexplained infertility implicates a role for these antibodies in blocking fertilization. Improved diagnosis and treatment of immunologic infertility, as well as identification of proteins for targete
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT1381748 hsa-miR-1208 CLIP-seq
MIRT1381749 hsa-miR-3607-3p CLIP-seq
MIRT1381750 hsa-miR-3686 CLIP-seq
MIRT1381751 hsa-miR-4420 CLIP-seq
MIRT1381752 hsa-miR-4426 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001669 Component Acrosomal vesicle IEA
GO:0001673 Component Male germ cell nucleus IEA
GO:0005515 Function Protein binding IPI 24722188, 25416956, 32296183, 32814053
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
605731 14105 ENSG00000137098
Protein
UniProt ID Q99932
Protein name Sperm-associated antigen 8 (HSD-1) (Sperm membrane protein 1) (SMP-1) (Sperm membrane protein BS-84)
Protein function Microtubule inner protein (MIP) part of the dynein-decorated doublet microtubules (DMTs) in cilia axoneme, which is required for motile cilia beating (PubMed:36191189). Plays a role in spermatogenesis by enhancing the binding of CREM isoform tau
PDB 7UNG , 8J07
Family and domains
Tissue specificity TISSUE SPECIFICITY: Expressed in testis (germ cells), but not in liver, kidney, prostate and small intestine. Expressed in airway epithelial cells (PubMed:36191189). {ECO:0000269|PubMed:36191189, ECO:0000269|PubMed:8788182}.
Sequence
METNESTEGSRSRSRSLDIQPSSEGLGPTSEPFPSSDDSPRSALAAATAAAAAAASAAAA
TAAFTTAKAAALSTKTPAPCSEFMEPSSDPSLLGEPCAGPGFTHNIAHGSLGFEPVYVSC
IAQDTCTTTDHSSNPGPVPGSSSGPVLGSSSGAGHGSGSGSGPGCGSVPGSGSGPGPGSG
PGSGPGHGSGSHPGPASGPGPDTGPDSELSPCIPPGFRNLVADRVPNYTSWSQHCPWEPQ
KQPPWEFLQVLEPGARGLWKPPDIKGKLMVCYETLPRGQCLLYNWEEERATNHLDQVPSM
QDGSESFFFRHGHRGLLTMQLKSPMPSSTTQKDSYQPPGNVYWPLRGKREAMLEMLLQHQ
ICKEVQAEQEPTRKLFEVESVTHHDYRMELAQAGTPAPTKPHDYRQEQPETFWIQRAPQL
PGVSNIRTLDTPFRKNCSFSTPVPLSLGKLLPYEPENYPYQLGEISSLPCPGGRLGGGGG
RMTPF
Sequence length 485
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Colorectal Cancer Colorectal cancer N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Frontotemporal Dementia Associate 22343411
Neoplasms Associate 28797028