Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
2619
Gene name Gene Name - the full gene name approved by the HGNC.
Growth arrest specific 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
GAS1
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
9
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
9q21.33
Summary Summary of gene provided in NCBI Entrez Gene.
Growth arrest-specific 1 plays a role in growth suppression. GAS1 blocks entry to S phase and prevents cycling of normal and transformed cells. Gas1 is a putative tumor suppressor gene. [provided by RefSeq, Jul 2008]
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT020112 hsa-miR-130b-3p Sequencing 20371350
MIRT025001 hsa-miR-183-5p Sequencing 20371350
MIRT025257 hsa-miR-34a-5p Sequencing 20371350
MIRT025983 hsa-miR-148a-3p Sequencing 20371350
MIRT025257 hsa-miR-34a-5p Luciferase reporter assay, qRT-PCR, Western blot 24220341
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 21357679
GO:0005886 Component Plasma membrane IBA 21873635
GO:0005886 Component Plasma membrane IDA 8127893
GO:0005886 Component Plasma membrane TAS
GO:0007050 Process Cell cycle arrest IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
139185 4165 ENSG00000180447
Protein
UniProt ID P54826
Protein name Growth arrest-specific protein 1 (GAS-1)
Protein function Specific growth arrest protein involved in growth suppression. Blocks entry to S phase. Prevents cycling of normal and transformed cells. Binds 20(S)-hydroxycholesterol (20(S)-OHC) (By similarity). {ECO:0000250|UniProtKB:Q01721, ECO:0000269|PubM
PDB 7RHQ
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02351 GDNF 166 243 GDNF/GAS1 domain Domain
Sequence
MVAALLGGGGEARGGTVPGAWLCLMALLQLLGSAPRGSGLAHGRRLICWQALLQCQGEPE
CSYAYNQYAEACAPVLAQHGGGDAPGAAAAAFPASAASFSSRWRCPSHCISALIQLNHTR
RGPALEDCDCAQDENCKSTKRAIEPCLPRTSGGGAGGPGAGGVMGCTEARRRCDRDSRCN
LALSRYLTYCGKVFNGLRCTDECRTVIEDMLAMPKAALLNDCVCDGLERPICESVKENMA
RLC
FGAELGNGPGSSGSDGGLDDYYDEDYDDEQRTGGAGGEQPLDDDDGVPHPPRPGSGA
AASGGRGDLPYGPGRRSSGGGGRLAPRGAWTPLASILLLLLGPLF
Sequence length 345
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Hedgehog signaling pathway   Ligand-receptor interactions
Activation of SMO
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Agenesis of corpus callosum Agenesis of corpus callosum rs754914260, rs1057519053, rs1057519056, rs1057519054, rs1057519055, rs1057519057, rs1384496494, rs1599017933
Hemangioma Hemangioma rs121917766
Holoprosencephaly Holoprosencephaly rs121917878, rs121917879, rs121917880, rs1572624159, rs137853021, rs397515364, rs397515365, rs2147483647, rs121909067, rs121909070, rs199476093, rs28936675, rs104894044, rs104894045, rs104894040
View all (76 more)
17525797
Hypothyroidism Hypothyroidism rs869320723, rs121908862, rs121908863, rs121908865, rs121908866, rs121908867, rs121908870, rs121908871, rs121908872, rs2140110277, rs121908881, rs121908884, rs121908885, rs786205080, rs1586182912
View all (22 more)
Unknown
Disease term Disease name Evidence References Source
Ambiguous genitalia Ambiguous Genitalia ClinVar
Asthma Asthma ClinVar, GWAS
Systemic lupus erythematosus Systemic lupus erythematosus GWAS
Borderline personality disorder Borderline personality disorder GWAS
Associations from Text Mining
Disease Name Relationship Type References
Cap Myopathy Associate 18974881
Carcinoma Basal Cell Associate 31988301
Carcinoma Hepatocellular Associate 39174588
Carcinoma Intraductal Noninfiltrating Associate 32050925
Carcinoma Papillary Inhibit 15619007
Colorectal Neoplasms Associate 33397428
Drug Related Side Effects and Adverse Reactions Associate 26215053
Esophageal Neoplasms Associate 34716287
Glioblastoma Stimulate 37609818
Glioma Stimulate 37609818