RIBC2 (RIB43A domain with coiled-coils 2)

Gene

• Entrez ID: 26150
• Gene name: RIB43A domain with coiled-coils 2
• Gene symbol: RIBC2
• Synonyms (NCBI Gene): C22orf11, TRIB
• Chromosome: 22
• Chromosome location: 22q13.31

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT022538	hsa-miR-124-3p	Microarray	18668037

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	22458338, 28514442, 33961781
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005737	Component	Cytoplasm	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005879	Component	Axonemal microtubule	IDA	36191189
GO:0005879	Component	Axonemal microtubule	ISS
GO:0005929	Component	Cilium	IEA
GO:0030317	Process	Flagellated sperm motility	IEA
GO:0030317	Process	Flagellated sperm motility	ISS
GO:0031514	Component	Motile cilium	IEA
GO:0036126	Component	Sperm flagellum	IEA
GO:0036126	Component	Sperm flagellum	ISS
GO:0042995	Component	Cell projection	IEA
GO:0160111	Component	Axonemal A tubule inner sheath	IEA
GO:0160111	Component	Axonemal A tubule inner sheath	ISS

Other IDs

• MIM: 621115
• HGNC: 13241
• e!Ensembl: ENSG00000128408

Protein

• UniProt ID: Q9H4K1
• Protein name: RIB43A-like with coiled-coils protein 2
• Protein function: Microtubule inner protein (MIP) part of the dynein-decorated doublet microtubules (DMTs) in cilia axoneme, which is required for motile cilia beating.
• PDB: 7UNG, 8J07
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF05914	RIB43A	1 → 309	RIB43A	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in airway epithelial cells. {ECO:0000269|PubMed:36191189}.
• Sequence:

  MGSQTMAVALPRDLRQDANLAKRRHAELCRQKRVFNARNRIIGGDTEAWDVQVHDQKIKE
  ATEKARHETFAAEMRQNDKIMCILENRKKRDRKNLCRAINDFQQSFQKPETRREFDLSDP
  LALKKDLPARQSDNDVRNTISGMQKFMGEDLNFHERKKFQEEQNREWSLQQQREWKNARA
  EQKCAEALYTETRLQFDETAKHLQKLESTTRKAVCASVKDFNKSQAIESVERKKQEKKQE
  QEDNLAEITNLLRGDLLSENPQQAASSFGPHRVVPDRWKGMTQEQLEQIRLVQKQQIQEK
  LRLQEEKRQRDLDWDRRRIQGARATLLFERQQWRRQRDLRRALDSSNLSLAKEQHLQKKY
  MNEVYTNQPTGDYFTQFNTGSR

• Sequence length: 382

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BREAST NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DENTAL CARIES	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Breast Neoplasms	Associate	32329860	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinogenesis	Associate	32329860, 38254916	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Associate	36714595	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Associate	32329860	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Associate	27517910	★☆☆☆☆ Found in Text Mining only
Hypertriglyceridemia	Associate	36077235	★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	32329860	★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Associate	32329860	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Associate	34530829, 34674573	★☆☆☆☆ Found in Text Mining only