Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
26146
Gene name Gene Name - the full gene name approved by the HGNC.
TRAF3 interacting protein 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TRAF3IP1
Synonyms (NCBI Gene) Gene synonyms aliases
CFAP116, FAP116, IFT54, MIP-T3, MIPT3, SLSN9
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2q37.3
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene interacts with TNF receptor-associated factor 3, tethering it to cytoskeletal microtubules. The encoded protein is also an inhibitor of the innate type I IFN response. Defects in this gene are a cause of Senior-Loken syndr
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs146820102 C>G,T Likely-benign, pathogenic Missense variant, coding sequence variant, non coding transcript variant
rs372499275 G>A,C Pathogenic Genic upstream transcript variant, intron variant, splice acceptor variant
rs750055952 T>G Pathogenic Coding sequence variant, non coding transcript variant, missense variant
rs764906529 G>- Pathogenic Splice acceptor variant
rs765903345 C>T Pathogenic Non coding transcript variant, coding sequence variant, stop gained, genic upstream transcript variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT050269 hsa-miR-25-3p CLASH 23622248
MIRT049550 hsa-miR-92a-3p CLASH 23622248
MIRT037104 hsa-miR-877-3p CLASH 23622248
MIRT717319 hsa-miR-320e HITS-CLIP 19536157
MIRT717318 hsa-miR-3184-3p HITS-CLIP 19536157
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001650 Component Fibrillar center IDA
GO:0001738 Process Morphogenesis of a polarized epithelium IDA 26487268
GO:0001738 Process Morphogenesis of a polarized epithelium IEA
GO:0001822 Process Kidney development IMP 26487268
GO:0001933 Process Negative regulation of protein phosphorylation IMP 22079989
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
607380 17861 ENSG00000204104
Protein
UniProt ID Q8TDR0
Protein name TRAF3-interacting protein 1 (Interleukin-13 receptor alpha 1-binding protein 1) (Intraflagellar transport protein 54 homolog) (Microtubule-interacting protein associated with TRAF3) (MIP-T3)
Protein function Plays an inhibitory role on IL13 signaling by binding to IL13RA1. Involved in suppression of IL13-induced STAT6 phosphorylation, transcriptional activity and DNA-binding. Recruits TRAF3 and DISC1 to the microtubules. Involved in kidney developme
PDB 2EQO , 8KCQ
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF10243 MIP-T3 5 117 Microtubule-binding protein MIP-T3 CH-like domain Domain
PF17749 MIP-T3_C 532 685 Microtubule-binding protein MIP-T3 C-terminal region Coiled-coil
Tissue specificity TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:12935900}.
Sequence
MNAAVVRRTQEALGKVIRRPPLTEKLLSKPPFRYLHDIITEVIRMTGFMKGLYTDAEMKS
DNVKDKDAKISFLQKAIDVVVMVSGEPLLAKPARIVAGHEPERTNELLQIIGKCCLN
KLS
SDDAVRRVLAGEKGEVKGRASLTSRSQELDNKNVREEESRVHKNTEDRGDAEIKERSTSR
DRKQKEELKEDRKPREKDKDKEKAKENGGNRHREGERERAKARARPDNERQKDRGNRERD
RDSERKKETERKSEGGKEKERLRDRDRERDRDKGKDRDRRRVKNGEHSWDLDREKNREHD
KPEKKSASSGEMSKKLSDGTFKDSKAETETEISTRASKSLTTKTSKRRSKNSVEGRKEDN
ISAKSLDSIVSGINNEPNQETTTSEIGTKEANINSTSISDDNSASLRCENIQPNPTEKQK
GDSTSDAEGDAGPAGQDKSEVPETPEIPNELSSNIRRIPRPGSARPAPPRVKRQDSMEAL
QMDRSGSGKTVSNVITESHNSDNEEDDQFVVEAAPQLSEMSEIEMVTAVELEEEEKHGGL
VKKILETKKDYEKLQQSPKPGEKERSLFESAWKKEKDIVSKEIEKLRTSIQTLCKSALPL
GKIMDYIQEDVDAMQNELQMWHSENRQHAEALQQEQRITDCAVEPLKAELAELEQLIKDQ
QDKICAVKANILKNEEKIQKMVYSI
NLTSRR
Sequence length 691
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Intraflagellar transport
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Jeune Thoracic Dystrophy jeune thoracic dystrophy rs764906529 N/A
Senior-Loken Syndrome senior-loken syndrome 9 rs886037896, rs765903345, rs886037897, rs886037898, rs886037899, rs745954112 N/A
Short-Rib Thoracic Dysplasia With Or Without Polydactyly Short-rib thoracic dysplasia 6 with or without polydactyly rs769651861, rs372499275 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Ellis-Van Creveld Syndrome ellis-van creveld syndrome N/A N/A ClinVar
Insomnia Insomnia N/A N/A GWAS
Psoriasis Psoriasis N/A N/A GWAS
Short Rib-Polydactyly Syndrome short rib-polydactyly syndrome, Majewski type N/A N/A GenCC
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Ciliopathies Associate 29068549
Disease Associate 21853134
Pulmonary Disease Chronic Obstructive Inhibit 32104517
Short rib polydactyly syndrome Beemer type Associate 29068549